FLASHBACK<<<<<<< REWIND
VOLUME 25
292 Date Aired: August 26, 2013….Perfect na nga ba ang lahat para sa pinakahihintay na proposal?
Naku…..ang mga titig ni Amiel kay Nikki girl!
Parang magkaka DE vs Mamang round 2. Fat burner. Ang kulit ni Mamang at Donya Esmeralda konti lang

Ang boses ni DE may hagod na pang mayaman. Lalo na sa “YEAH”
Medyo lumitaw ang pagkasosyal ni Mamang dun sa banter nila ni DE
ETIQUETTE
There are things in life that, we normally take for granted… like assuming that everyone knows how to behave, what to do, and what not to do while visiting someone’s home. When we invite or are being invited for a meal like lunch or dinner by family, friends or the like, we normally expect to have pleasant conversations that will surely enhance the dining experience. There are topics that should be left at the door so as not to upset someone’s appetite by saying inappropriate words that are and be offending.
The lunch invitation by DE and DR initially had been a cordial one with pleasantries and proper decorum observed. DE had been a gracious hostess and NT and Mamang grateful for the invitation. Everything was in order … until the two matriarchs opened their mouths and started their tirade exchanging words poking at each other in a very childish fashion. While the two matriarchs kept badgering one another, the civil DR and NT found themselves at the center of the two and had to set aside their differences and tried their hardest to pacify or make the situation much bearable for everyone’s sake. Looking after DE and Mamang, they literally forgot that just a day prior, they too were exchanging disapproving looks and negative feelings and yet now they opted to set aside their differences to join forces to appease the heating arguments brewing between their loved ones, DE and Mamang, all for the sake of the grace they were sharing and more importantly for the two beautiful people that they all loved and cherished of whom were put at the center of all this conflict and chaos that they have inadvertently created.
As the two matriarchs tried outdoing each other, outshining one another, both ended up not eating properly and remaining famished and both ended up eating lunch again away from the prying eyes of each other. In the end, both pretending to be somebody other than they truly were… putting their perceived best foot forward setting aside what they truly were and who they truly were.
If we are to pick a lesson or two in this scenario is that, when having a lunch or dinner with not so familiar guests, it’s always good to let the spirit of friendship be our guide in dealing with guests. It will always be nice to act cordially, gracefully and with utmost respect. And if conversations will be part of the lunch or dinner, may we always try to keep the discussion pleasant… something lighthearted… not too controversial and leave the debate or arguments outside the door and we are not sure of the each other’s tolerance, may we don’t bring anything that might cause someone’s stomach to tighten.
In all the chaos brought about by two families meeting and hoping to warm up with one another for the sake of the two people that brought them all together, may they eventually set aside their differences, their idiosyncrasies’ for their loved ones that’s at the center of these two families. May the love that brought the two individuals resonate to their families and may they join the couple in looking together in the same direction, forwarding looking to a harmonious relationship not only between the couple but between the two families that will forever be connected whether they like it or not.
===================================================================================================================
Sharing with everyone some a list of safe, pleasant topics that can probably be the discussion point in situations like what we’ve witnessed between the Lims and Dela Rosas lunch encounter:
• Food – It is always a good idea to discuss something we like about the food we are eating. The host or hostess will be flattered, and if everyone else is eating the same meal, they can add their thoughts. We can probably add an anecdote about similar food or ask for the recipe.
• Fashion – A nice compliment will endear us to others so let’s find something pleasant to say about someone’s outfit, jewelry, or hairstyle. We might learn some fashion tips if we give the other person that chance to respond.
• Music – Most people enjoy some type of music, so that can be a safe topic at the table. We can share thoughts about our favorite entertainers, composers and probably share about a concert or symphony that may be particularly enjoyable.
Ang gwapo naman ni singkit! Ano ang alibi kay Mayabels??
Selos ang Nikki! Baka mabuking ka nyan ni Luke!
Kaloka magpakonsyensya si Kute!
Waaaaaaaah… ang reaction ni DE at Conchita!
Si manang Fe at Dorbel susunod na!
Hayan mapipilitan na sila magclick sis! Si mamang parang tigre!
Zel MThese are the topics to avoid:
• Medical conditions – Health problems, particularly if they involve body fluids, will destroy many people’s appetites at the mere mention of them. Unless of course we are enjoying a meal with doctors, nurses, and others who don’t flinch at the sight of gushing blood, it’s best to leave that talk for another time.
• People’s age – Although we may be proud to have lived to the ripe old age we are, the person sitting across the table might be depressed about aging. Don’t ask someone’s age or discuss the act of getting older.
• Politics – Unless the dinner is being held in honor of a political candidate or is happening in the midst of a political convention, leave all talk of politics for later.
• Religion – Never offend anyone of a different religion. If the host offers a prayer or blessing before the meal, be respectful and follow the lead. We may say our own private prayer if we are of a different religion, but never call attention to our self when doing so.
Kakaaliw si DE at mamang… lalo na yung reaction nila 2 nung nasabi magpropropose na si Richard kay Maya… ang mas nakakaexcite kung panu lulusutan ni SC pag nakita ni Maya na may kausap si SC niya na ibang ghel.
Kaloka tong si SC sinabi talaga kay Maya kung saan ang meeting. Fishing si Maya.
Soco soco na si Mayabels… hahaha… si Atty. Ryan ang kasama mo SC ha… wahahah
at sinabi pa talaga ni Ser Chief san place siya pupunta sa gabi kay Mayabels!
Lagot si Ser Chief at handang handa na i-soco siya ng future wifey nya!
Daig ko pa ang baliw tawa ako ng tawa… adik tlaga ako.. eto na yung kay manang Fe, Doris at Sabel.. tili na tili… wahahaha… hindi mapigil ni de… wahahaha.
Sukiyaki 616
Kinabukasan naganap ang Round 2
Ni Mamang at Dona Esmeralda
Si Nanay Teresita at Don Roberto
Pumagitna nag-referee sa kanila
Halika at panoorin ang laban
Battle of the bulge ating tawagin
Ayaw malamangan di maiisahan
Papayag kaya na sila’y timbangin
In this corner weighing….. huluan ninyo
Ang milyonaryang Dona Esmeralda!
In this corner weighing….. patawarin ninyo
Ang nag-iisa nating Mamang Conchita!
Mag-iingat nagkaka-edad ka na sabi ng Dona
Iwasan lahat ng pagkain ang kanyang payo
Si Mamang di nakapagpigil nanlaki ang mga mata
Fat burner pills? Para namang walang epekto sa’yo!
Si Nanay napapapikit hindi makakain
Pinigilan si Mamang higpit hawak sa hita
Mga prutas at gulay na kanilang inihain
Life is short, let’s eat, ang Don biglang nag-anyaya
Kinagabihan ang sikreto ni Ser Chief ibinunyag
Na sa pag-aakala ang balita ay maitatago
Hindi nagtagal ang mga tao natuwa’t nabuwag
Masisira kaya ang secret proposal ni Ricardo?
Walang selosan blues. Nabuking agad ang impending proposal.
Naudlot ang pagselos ni Maya! Emman!!!
Ikaw na talaga Emmannnnn!!!!!! ang panira ng moment…
Jimuel dela Cruz ‏@Jimuel 1m
Yes, this isn’t the typical set up. Maya knows about the proposal. Ang tanong, how will it happen? Abangan!
Tayo ang na-SURPRISE!!!
Si Ms. Connie Abueg ba yung nasa magazine na tinitingnan ni Mamang ?
Hay naku Emman. hindi na surprise ang THE PROPOSAL kay MayA.
Ita RSHE WEARS MY RING
=====================
maya will soon be wearing an engagement ring from SC. i found this goodie oldie song that tells us
what the ring represents, as sung by the inimitable king of rock & roll, elvis presley.
ayayay! listening to the song gives kilig-much experience.
(btw, i have you in mind, suki-san, when i found this song…as you would always write, elvis has just left the building!)
=============================================
SHE WEARS MY RING – cover/version elvis presley
http://youtu.be/_LTwkbu3MKA
She wears my ring to show the world that she belongs to me
She wears my ring to show the world she’s mine eternally
With loving care I placed it on her finger
To show my love for all the world to see.
This tiny ring is a token of tender emotion
An endless pool of love that’s as deep as the ocean
She swears to wear it with eternal devotion
That’s why I sing, because she wears my ring.
She swears to wear it with eternal devotion
That’s why I sing, because she wears my ring.
This tiny ring is a token of tender emotion
An endless pool of love that’s as deep as the ocean
She swears to wear it with eternal devotion
That’s why I sing, because she wears my ring
That’s why I sing, because she wears my ring.
=================================================
sending good positive vibes to everyone! tyvm, bcwmh!!!

Nakapagrenda pa ang Dorbel! Wanted na naman si Emman!
Eh sa lahat ba naman ng lugar na pwedeng magkita- sa mall pa! duh hello!
Napilitan na lang siguro sila kasi nagseselos na si Maya!
Kawawang Emman! Laging siya na lang may sala. Wagas sa reaction sina Nanay, at si Mamang. Si Kute ang kulit! Quits lang kayo at di na raw teenager si Mamang para ma hurts!
Winnie R OntiverosOur story today continues with Nikki, Luke and Abby in the car on the way to school. Nikki was checking out Amiel on her FB page. Luke asked her if he is Mallows and Nikki explained to him that he is a transferee and she had to accept his FB request in favor of West Teatro. Luke reminds Nikki of their meeting this afternoon and casually mentioned that Nicolo and him invited a couple of Music & Sounds senior members to help them. She said no problem.
At the airport the beautiful FA’s are walking the hallway and talking to Edz. Maya tells her to stop her crying now. Why? Edz asked, is it because of her make up? Maya said it is just wasted effort. She tells her it’s ok to cry once or even twice. But if she cries for the third time that is over acting. It’s wasted tears and she could still save it for another person. It made Edz chuckle and the others laugh. Maya continues to make her feel better by saying she doesn’t want to cry for they sound like they are mourning over Edward who is still alive. Everyone laughs. The other FA mentions that the “Singing Pilots” have a gig tonight. The girls all decided to go except for Maya and in unison they all said she couldn’t come because “I have to go out with Ser Chief tonight.” Ha ha (These girls are so cute. They are all being silly and crazy but still with poise. I admire them. I could see where Maya had transformed herself from a silly, giggly, loud Maya as in the beginning of the series and now. It made her character so true to life.)
At the hospital, Mamang’s lab tests are over. She complains about how expensive it is and she is hungry. Simon asked if they want to have merienda (snacks) before he takes them to Richard’s? Nanay T reminded Mamang that Dona E prepared lunch for them. Mamang had no choice but to wait.
At PUS, Nicolo talks to Luke about the meeting they are having this afternoon with their teams for the music video. Luke tells him to stop talking about that and focus on their exam waving a book on his face. Nicolo tells him he’s done studying and he feels he is going to ace that exam. Luke said he is mayabang (boastful). At this time, Ange and Cheska walk by. They say hello to one another. Ange confirms their meeting this afternoon to Luke and he said yes and thank you for helping them. Ange invites Luke to have fishballs (Oh my gooseneck this woman does not know how to eat anything else but the dang fishballs. And there is no inkling that she is Mang Greg’s daughter who is the scholar of the school. But maybe she is embarrassed to admit because of peer pressure? Whatever…I am not losing hope that there is a story angle about this later. You know these writers they are clever.)
At the NHHS, Nikki was having a meeting with the West Teatro group. They talk about the 21 new members until Amiel shows up and yells, 22 to add his self. Nikki introduces him to the rest of the members and then reminds them to keep posted for meeting announcements because they are going to start casting for their new play. Everyone was dismissed. Stacey asked Nikki if she is joining them at the mall this afternoon. Nikki said she is going to the University for Nicolo and Luke’s music video meeting. Stacey wonders why she is helping them and Nikki tells her its because she doesn’t want the boys to ask help from those “maarte” (superficial) college girls. Amiel eaves drop at their conversation (Hmmmm…Amiel to me does not have a strong arrive {“dating”}. I do not see what the casting director sees in him.)

Super funny at aliw ng episode today.
O ayan, aalis na papuntang Europe si Connie kaya bawas selos na.
Si Nikki super asar pa rin, dense talaga si Mallows di daw si Amiel ang mallows, hala sana magselos siya kay Amiel! Ikaw Niccolo!
Hot WasabiTHE OPEN SECRET
A secret is information that is concealed and closely guarded by its initiator and a privileged few from other people’s knowledge. These privileged few are usually prequalified individuals who can absolutely be trusted to keep confidential information. However, it stops being a secret when someone outside of that inner sanctum gets a whiff of it. And that is exactly what happens in this episode. Although Emman unknowingly spilt the beans by declaring the identity of the mysterious woman that Richard had an appointment with, he is not really to blame for ruining Richard’s surprise secret for Maya. A series of unfortunate events contributed to the unraveling of this most important secret that led to this eventuality.
Richard initially tells his father and Nanay Teresita of his plans to propose to Maya. It is basic courtesy for a man to ask for the future bride’s hand in marriage from her parents, after all. Out of respect for his own, Richard also tells his Dad about his intentions. He extends this initial privileged circle to include his children because he feels it is an important decision that they need to be privy to. He wants to keep the integrity that he momentarily lost when he opted to keep them in the dark regarding his relationship with Maya. He witnesses firsthand how hurt Luke and Nikki felt when they discovered that their father kept a secret from them. They prefer to be told instead of uncovering it after the fact. Hence, following the concept of keeping successful secrets, Richard, the initiator of the privileged information tells five people his secret. He trusts that these five will keep the information in confidence. But we know that two of the five, violated the vow to be silent.
Don Roberto and Nanay Teresita share Richard’s secret with Dona Esmeralda and Mamang, respectively. With the latter two seemingly locked in a fierce game to outdo each other, the former are left no other alternative but to appeal to the latter’s sensibilities to keep the focus from themselves and direct their attention outwards. To effectively put a stop to their trivial verbal squabble over petty matters, Don Roberto and Nanay T voluntarily share with the bickering matriarch’s Richard’s secret proposal plan. And it works. The two immediately retract their fangs and cease their silly arguments.
However, in her excitement, Dona Esmeralda is unable to keep the secret to herself. Such great news seems to easily grow wings and fly on their own. So, inspite of herself, she shares the supposed secret with Manang Fe. In the process, she is overheard by Sabel and Doris. Thus, the secret’s inner circle has just been unintentionally broken into without Richard’s knowledge. It is now out of his control.
With more people having knowledge of the secret, there is a good possibility that its security will be compromised. Sabel’s eagerness to goad Maya to confess the progress into the latter’s romantic life, she voluntarily discloses Richard’s late arrival home the night before. Maya’s curiosity is effectively piqued because Richard led her to believe that he was going straight home sooner than Sabel’s account. Maya’s mind is presently going on overdrive. She actually entertains the possibility that Richard is keeping a shocking secret from her. What with the most recent tragic breakup between Edward and Edzeline still fresh in her mind, she could not shake off being fearful that something is going on behind her back, as well. Consequently when Maya sees Richard with an attractive woman, who obviously does not look like Atty Ryan, the appointment he claimed he had when he cancelled their date, she is visibly upset.
Indeed, Richard has a secret from Maya. However, it is not one that should harbor any fear in her heart. It is in fact the secret to a romantic progression to her love story with her handsome and loving beau. When the secret is finally revealed, she will essentially be catapulted to an ethereal existence for quite a long while. Doubtlessly, she will definitely be transported to Cloud Nine when she finds out what Richard is actually up to.
Magkaka apo tayo uli pag nag asawa na si Maya-mamang…at kinilig ako sobra sa dialogue ni mamang.
My thoughts regarding today’s epi:
-Laughtrip talaga ang battle of the heavyweights!!! Pati sa prutas competing pa rin. I’m sure we’ll see more of those hiritans-lighter and kuwela version when they become official in-laws.
-I love DR and NT playing as referees.
-May contest ba ang mga characters na pa-wagasan ng tili sa pagkakaalam ng proposal? Sinong panalo?
-Nikki Grace Lim- Ikaw ang magbubuking sa sarili mo nyan e. May minana ka rin pala kay Maya.
-Ricky Boy, sana kasi sinabi mo na lang na business partner ang ka-meeting mo. Ginamit mo pang lusot si Atty. Ryan. Ayan tuloy, na-SOCO ka ng future wifey mo! (Pero may 10 pogi points ka sa kin kasi you said ‘I love you’ first)
– At… Emman! Emman! Emman! Ang pambansang panira ng moment! Ngayong alam na ni Maya, hindi kaya joint forces na ang lahat para maisagawa na ang proposal? How will it be memorable e di na sya surprise? Hmmm, is Ricardo the one who will be in for a big surprise? Baka good-timin sya ni Mayabels. (Ang galing ng writers! I never expected this twist!)
Winnie R OntiverosWaaaa Sis i am still a bit disappointed that Ehman had to tell Maya and maybe just to appease her because she is already feeling bad about seeing Richard with another woman. I do not understand why Richard could not email, fax or send the specifications via messenger. Why does he have to meet with that woman in the middle of the night. Boooooo! Ha ha i am so dang jealous for Maya. I didn’t like how it looked when he was helping her to her chair and all. I know i know she is the jeweler and there is nothing going on but i am still jealous ha ha….ako kasi si Maya sa isip ko…ay lukaret ha ha

Kaloka ka Emman! Spoiled na ang surprise. At tama kayo mga gehls… tayong mga adik ang nasurprise.
Si SC naman nag name drop Atty Ryan sana kinonchaba na nya lang at pinapunta nya rin sa venue. Pero good boy nga si SC… sinabi nyang venue ng tunay. Yung nga lang… buking tuloy. Well di rin nya ineexpect si Maya na magdududa.
Hot WasabiM&Ms,
This is my suggestion to the Creative Team on how to design Richard’s proposal to Maya. Richard can employ the help of Nikki’s West Teatro group and Luke’s Sounds and Music group to pull it off. At the same time, he can ask Emman to organize Maya’s co-workers to show up at the venue. I think it would be such a hoot.
Please watch this you tube video that was done by Jamin’s Downtown Disney Flashmob Proposal using the music “I Wanna Marry You.” He proposed to his Filipina girlfriend. It is so cool. She was totally surprised.
One of the possible major positive effects of Emman’s spoiler about the proposal is mahahanda si Maya to say YES to the proposal. Sana nga… If this will be the case, I would thank Emman.
By the way, I saw some BTS pics sa BCWMH FB. SC and Maya are in a restaurant. Given this, mukhang di naman talaga mahaba ang jellybeans saga (‘Thanks’ to Emman!)..
Winnie R OntiverosAt the mansion, DE and DR welcome Mamang and NT at the door for their lunch date. They make nice nice to one another. I give one point for DE for she really is reaching out to them. (DE almost called Mamang Esmeralda ha ha ooooppps!) Mamang acted a little snooty. At the lunch table, DE brags about having the lunch menu specially prepared for Mamang and NT. During their small talk, DE tell them that she has been diagnosed with HBP as well. At the beginning, her MD placed her on a strict all veggies diet. NT thanks her for her concern over Mamang’s condition. She insinuates in her reply that this condition attacks elderly people. (oopppsss!) This doesn’t sit too well with Mamang so she rebuts her and said that she isn’t old yet. Mamang said that maybe she is referring to herself. DE admits she is older than Mamang but she said that she does not look like it. In fact she looks like she is just the same age as Mamang. (Uh oh!) DR and NT got tensed over the conversation so he urges everyone to eat. NT seconded that motion and started to hand out the bowl of rice. She tried to ask Mamang to eat but she refuses. DE brings out her vitamins and shows Mamang the fat burner pills. She said it is for weight loss. This, once more, does not sit well with Mamang. She asks DE if she is insinuating that she is overweight? (Oh my my my…the subject of weight is a very sensitive matter so this is going downhill if you ask me.) DE hesitantly tells her “a little” with a finger gesture. NT puts her hand on Mamang’s lap and squeezes it to signal control. Mamang refuses to take the fat burner vitamins. She tells DE while looking her up and down that she does not think those pills are effective. (Uh oh…now it’s DE’s turn.) DE asked Mamang if she means that she is overweight? Mamang said, “maybe just a little” with her finger gesture. (Kaboom! Ha ha). DR had to interject and tells the group that life is short so they shouldn’t worry about it. He encourages everyone to eat all they want to eat. DE and Mamang were both unamused. DE said she will just eat fruits and Mamang said the same thing. They both reach over and stick their forks at the same slice of orange. (Bwahaha I laughed so hard at this scene. And the music makes it so hecka funny!)
Richard is busy at work when Liza came in the conference room to tell him that Consuelo Abueg called and wants to meet with him tonight. Liza explained that she is leaving to Europe in the morning and would like to really have his specifications before she left. (Hmmm, me thinks Richard could email her the specs and talk about it over the phone? No need to meet. I mean we are in the 20th century. No excuses.) Richard had not choice.
Meanwhile, Maya arrives home from work. She was surprised to see Mamang eating. NT tells her that it is because Mamang only ate fruits for lunch. Maya wondered if it is because of her lab tests? NT chuckles and tells Maya Mamang is jealous of DE that is why she is dieting. Maya tells Mamang not to worry because she is in fact the sexiest grandmother ever. Mamang knows Maya is just encouraging her but she is grateful just the same.

Laugh trip ako kay Donya Esmeralda na trying her best na wag sabibin kay manang Fe about the proposal. Nagtitimpi na nang gigigil kung sasabihin o hindi kay manang Fe sa plano ni Ricky.
Sukiyaki 616Hot Wasabi, right you are, an open secret! Gosh, the mouths of Dona Esmeralda and Isabel are as big as their waistlines. It was funny though that from out of the blue Doris and Sabel jumped out screaming. Very disappointing but it is very intriguing what the writers have in store for us again. Once again, you do not disappoint with your edition, HW.
Di kaya sa ibang paraan mag-comeback ang reign ng pagiging Ms. Assumera ni Maya Dela Rosa and hindi sa jellybeans moments like what we were thinking?
Iniisip ko kasi na if she already knows about the proposal, konting galaw ni SC iisipin nya na para dito yun. Yung parang pagiging assumera nya before nung crush palang nya si SC?! Kilig much naman kung ganun!!!
If ganito, sana may mga scenes na hahayaan nya si SC to have more time to do his own thing kasi isip nya paghahandaan yung surprise for her. O kaya naman, iisipin nya na kada labas nila na “This is the moment.” Tapos, hopia pala sya.
Para medyo surprise pa rin and memorable pag totoong proposal na. And medyo I miss the scenes na parang may thrill si Maya sa pagiging hibang nya kay SC. I miss her ‘patay na patay’ kay Ser Chief moments. That’s what we loved about the show nung una.
Suki,
The way the two screamed silently reminds of how do the same when we laugh or scream so loud in the middle of night. We suppress our scream or laughter in deference to our housemates. ha ha ha. I thought this was the funniest scene in the entire episode.
Zel,
Yes the invisible smoke signal works. ha ha ha. Let us see how Richard is going to remedy the situation. I think babawiin na lang niya ang proposal in the way that he will do it. Yun ang aabangan nating lahat!!!
Actually ganito yang reaksyon kay Emman eh, at first masarap talaga siyang balatan ng buhay at mukhang hindi mo siya mapapatawad pero kapag naprocess mo na at naisip na ang possible scenes, those ‘kunwari-hindi-alam-ni-Maya-ang-proposal scenes (which will be soooo hilarious!!! )Okay ka na! At yun nga, mapapa BOW ka rin sa mga writers talaga kasi it is, still is your not typical teleserye!
Evangeline TasipitKabsat H-wasabi, you are absolutely right its an open secret …. But its a good one . I don’t know if I will blame Ser Chief because he shouldn’t told to anybody yet, well he can tell to Manang Fe because she can 100% sure keep secrets but the others no …. But because its Ser Chief I will not blame him.

Since nabuking ang planong proposal, bet ko ang mga hula ng mga adiks na it would be na si SC ang ma surprise sa proposal na magaganap. Maya might say NO muna pampa-KABA kay SC hahaha.
Or since alam na ng lahat ang planong proposal, Maya might make kuntsaba the whole gang, except for SC. And SC also doing his plans with the whole gang, except for Maya.
But Lim and De LaRosa Family plus the others will plan out the proposal surprising both Maya and SC! Walang kamalay malay ang lovers na walang masusunod sa mga plans nila bwahahha! Will turn out na Lim at DLRosa family will do the proposal to both of them instead….That would be hilarious!
Nothing’s impossible sa mga BCWMH writers! Ang saya saya lang!
Winnie R OntiverosAt Chefjess, the Luke and Nicolo meet with Cheska, Ange and Joey when Nikki arrives to join them. Luke introduces her to the group. He said they are the M & S senior members that are going to help them with the music video. He said Ange is on Team Luke and Cheska on Team Nicolo. Niknik is not amused. She reacts to Cheska on Nicolo’s team probably remembering her name as mentioned by the two before. She makes an announcement that she is bowing out on Team Nicolo using the excuse that she is too busy with West Teatro. Joey somehow understands but Nicolo tried to stop her. He said he is going to lose a partner. Nikki looks at Cheska and said that all is well since he’s got a senior member of the M & S on his team. She deemed her more qualified to help Nicolo. She storms out. Nicolo was saddened and Luke followed her outside. He asks Nikki what that was all about? Nikki explained to him that she only stopped by to tell them she’s out. She only wanted to personally tell them that. Luke was confused. Nikki forces a smile to cover up what she really feels. (Oh my G Nicolo you are so in trouble. You need to just stop looking at other girls and flunk all your subjects so you could stay at the university long enough to wait for Nikki. Only two years and she will be there. Geese. Drop that Cheska. She is not the right one for you.)
Back at the mansion, Richard was having a snack with his parents. DR was having coffee but DE was having an entire meal. Richard asked her how their lunch went? DE tells Richard all is well and it was fun. Richard wondered why she is eating again? DR tells Richard that she just ate fruits for lunch because she was envious of Mamang and started a diet. DE denies and said that she is just being polite because Mamang is not allowed to eat a lot so she didn’t either. Thanks Ma said Richard. (ok you got a good excuse DE)
On the phone, Mamang tells Kute what happened at lunch. Kute was telling her that it is embarrassing to Richard. NT listens in to their conversation. Kute encourages Mamang to be civil to the Lims. Mamang said she thinks they are just not “clicking”. NT tells her that she needs to “click” with DE. At the mansion, DR asks DE why she didn’t tell Richard the truth about her and Mamang. DE said that she is going to be patient and just let it go since it will only be every once in a while. DR tells her she better gets used to it. Mamang asks why is it important that she gets along with DE? She isn’t going to see her often anyway? NT then tells her Richard is about to propose to Maya. DE asks DR why does she need to get used to dealing with Mamang? DR tells her that if she didn’t she might ruin everything. Richard is about to propose to Maya. Both matriarchs were dumbfounded! (Surprise! Ha ha I can’t wait to see how you two become bestest buddies after this. Ha ha) Waaaaaa! They both jump for joy! Yeay! Said Dona Esmeralda….she asks what are Richard’s plans and if he already has a ring? Mamang asked NT how Richard is going to propose? Did he say when? DR said he doesn’t know about his plans or a ring yet. NT tells Manang she doesn’t know the details yet because Richard has not told her. DE said this is the best day ever and nothing is going to spoil it for her. Mamang is so excited thinking of more grandchildren when Maya and Richard get married. They are both so giddy about the thought. (I am joining both of them in the joy and excitement. I can’t wait to see the proposal.)

Must watched the episode today.I guess nasabi ni Emman yung proposal kasi nagduda na si Maya na merong ibang girl based na rin sa sinabi ni Sabel & Doris na gabi midnight na umuwi so sinundan since hindi pwede si SC sa dinner + the fact na nagsinungaling si SC na si Ryan ang ma-meeting then nakita nila na girl pala. Sa excitement at nakita pa sa magazine yung girl so di napigilan ni Emman.
Excited to see yung buong reaction at sasabihin ni Maya sa sinabi ni Emman at kung pano nya haharapin at pano sya magri-react pag nagkita sila ni SC.
Bet ko na hindi sila nakita ni SC sa resto.
Excited na naman for tomorrow.Grabe napaka unpredictable.tayo ang nagsurprise.
Ito talaga si Ser Chief kunwari sa lips ki-kiss pero sa gilid na naman ata ng lips! At si Maya naman… kaloka ang papunas-punas ng lepppps!
Still the same pa rin ang effect! KINIKILIG pa rin ako!
Winnie R OntiverosRichard and Maya talk on the phone. Maya is so happy that it seems the two families are getting along well. Richard is too. Maya thought of celebrating tonight. Dinner? She asked. Richard tells her he isn’t going to be able to see her tonight. He makes up an excuse that he is going to meet Atty Ryan to go over the last minute changes on the contract with Singapore Lines Express. (Uh oh Richard…Lightning might strike you ha ha) Maya was disappointed but tried to understand, after all it’s all about work. (No Maya it’s all about you and your engagement ring)
At the mansion, DE is so excited over the news. (This is the funniest part of this episode. I was ROFL) She walks in the kitchen where Manang Fe is chopping up veggies for the next meal. She could hardly contain her excitement and at first she tells Manang Fe that she could not tell her. Then she thought that since this is Manang Fe and she is one of the most trusted people in the household. She knew she wouldn’t tell if push comes to shove so she excitedly tells her that Richard is going to propose to Maya. Manang Fe and her scream and jump for joy. DE claps and waits for a high 10 from Mamang Fe but Manang Fe is older than dirt and didn’t get it. She just keeps jazz hands apart and jumps up and down. But the screaming is twice as loud because the screen pans out to…tada!!!!… Dorbel!… They were jumping up and down and screaming just as loud. It seems they overheard the two. They too were screaming for joy. DE tells them to hush because it is supposed to be a secret. Dorbel promised they will keep it a secret so they act like they are screaming but with no sound. (Bwahaha this is exactly how I look like when I am hidden in the closet and watching the kilig moments of this show…screaming out without a sound ha ha I so love this part)
At the grocery store, Maya and Ehman shop for fruits. Ehman asks Maya why she has twice as many fruits? She tells him that she is giving the other basket to the Senior Lims for a warm welcome to NT and Mamang. He is happy for his roommate. Meanwhile, back at the mansion, Nikki arrives home. She is so upset at Mallows. She isn’t in a good mood. She again self talks and reminds herself that she is going to evade Nicolo once and for all. Dorbel sees her at the foyer. With their excitement, they greeted her. She didn’t respond to them and stormed upstairs. The bell rings, Dorbel checks the door? It’s Maya and Ehman stopping by to drop off the basket of fruits. They have the cab waiting so they didn’t go inside the house. Dorbel happened to mention to Maya that Richard came home late last night and they thought he came from Maya’s house. (Uh oh!) This left Maya wondering where Richard would have gone last night? She remembers him saying he is tired because they had a lot to do at work all day. Hmmm think think think Maya!
Next Time on BCWMH
At the Lims, DE, Manang Fe, Luke, Nikki, Abby and Dorbel were huddled up at the dining table looking at bridal magazines. Nikki was talking about the different ways that people propose that seemed popular. She talked about people proposing in front of a big crowd where it could be recorded and shared easily with others. Don Roberto reminded Dona Esmeralda that she wasn’t supposed to tell anyone about Richard’s plans. She tells Don R that she didn’t mean it. He reminded that proposals are supposed to be between two people only. Dona E nods. At the mall, Ehman and Maya continue to talk about Richard and what he seems to be hiding from Maya until Ehman spots Richard and Ms Abueg walking. He quickly pulls Maya to hide behind the Sale banner. They watch Richard help Ms Abueg to a chair. (Oh my G this doesn’t look good although we know what its all about, just the scene does not look good. Even I got jealous. I don’t want to see Richard walk or talk with anyone but Maya ha ha) At the condo, Ehman tells Mamang and NT what they saw at the mall. NT couldn’t believe her ears. Mamang then mentioned that maybe that woman is someone Richard is talking to regarding the wedding. Wedding? Ehman asked. Then Ehman must have done some investigating because he tells them that Ms Abueg is the best engagement ring maker in town. He puts two and two together and tells Maya that Richard is going to propose to her…Waaaaaa! I scream!
Ang perfect kasi eh, gusto ko yung medyo may LQ, selos mode si Maya, nagpapakyut si SC, ang spontaneous ng galaw (read: parang hindi inaarte! ) may tunog yung kiss! Ah bashtaaaaaaaaa!
Hinahabol habol ni Ricardo ang labi ni Mayabels tapos tapos si Maya ano ba di ba dapat ayaw niya, bakit siya nakanguso? Medyo di makausad.
Hot WasabiHello Win,
Happy First Day of School. ha ha ha. Did you survive it?
Happy to read your post today. Glad you posted early. Just one thing I wanted to bring to your OCD attention and a personal observations.
1. The school that Nikki attends is called NMHS, North Hills Montessori High School.
Observation?
1. The verbal ping pong between the two matriarch is a fun one. The creative writers must have had a great time writing their lines. ha ha ha
2. I kinda like Amiel showing his interest in Nikki. I want Nikki to appreciate him. They are both in high school which is more appropriate as they are almost close in age. Unlike Nicolo, he is in college and he is wishy washy with his feelings for Nikki. Nikki is the only one showing her interest in him. I would rather her be chased than for her to do the chasing.
That is just my take.

Hahaha! pero muntik na akong kinabahan kina DE and Mamang ha! pano kaya sila kung maging magbest friends naman sila? sana maging ganun para everybody happy!!
Naintriga ako sa psot ni sir jimuel, am sure pasabog na naman ang proposal ni SC! naku crucial moment kaya yan, bigger than the hug or the kiss!!!

2319 days agoSweety PieHaaay Emmy…what can I say..oh well I think Maya is more ok with her knowing it in advance than a suprise coz she said before when
Charlie proposed to Raffi na if its her, she will faint for sure…at least now she is ready with her makeup, perfume and everything…lol
But I will just tag along to where our creative writers will take us…fasten your seat belts….Wheeeeee!!!
Haven’t watched today’s episode yet.
kaka-surprise to know na malalaman ni Maya because of Emman. Didn’t expect that.We all thought na selos ng bongga si Mayabels.
Eto na naman siguro magpo-propose si SC ng walang kaabog abog.Yung bigla na lang na walang sign or wala v maghihinala.Parang yun second kiss nila.Bigla na lang.
Di ko mahulaan how.galing lang ng mga writers 👍
Getting to Know Each Other, Richard Yap
Waaaaaaaaaaaaaaaahhhhhhhhhhh!!!
Going GAGA over the videos!!! Thanks Sis Tinay!!! OMG!!! F na F lang ni RY ang song!!! Oh well!!! Waaaaaaaaaaaaaahhhhhh sunod naman Sad To Belong naman!!!
Elibs ako sa nagvideo as ZOOM IN. Ang bilis mawala ni SC sa frame pero nahahabol naman nun kumukuha. Super thanks sa nagshare!
O sige na nga, fish, sa song choice na lang tayo…
Tingin ko most of the 80’s songs bagay sa kanya. Pwede rin ang 90’s band songs na swabe like Ligaya, Perfect, Harana, Ako’y Sa ‘Yo, Ika’y Akin etc.
Agree ang daming makakarelate nyan. Lahat ng dundaam ng high school di maaring mahilig sa era na yan!
Lalaki pa ang crowd nya. ( ayan ha purely singing career ang topic naten )
Kelan kaya album launching ni RYap?
For sure mag guest siya ulit sa ASAP and other shows pa to promote the album!
Hintayin ko ulit si Chinito gisahin ni Vice Ganda!
Willand Cebedoto all the minkies in the house. i am disappointed with today’s episode. i am not always
a saint so i cannot hide my displeasure with mamang behavior or lack of it.
donya esmeralda was kind enough to invite them again to amend what had happened
before. because they were guests in the house. the guests should be aware to act in the
manner that would be more or less pleasing to the hosts. and also vice versa.
mamang behaved like a brat and small kid. no matter what, donya esmeralda was very
patience in condoning her behavior
one thing i don’t understand is why the de la rosa family like manang theresa cannot even
scold her mother for unsocial behavior even though the lim family are doing what they can
to be a good host in the their own house. is this the typical behavior we have inherited from
spanish? i believe so because i have seen a lot of these people around. too much pre madonna.
another major major disappointment.
what is left to the surprise now for maya. everything is divulge big time. even their
lost parrots kirikit at si kirikat know about it. the writers must have some kind of better
ideas that are coming because they would never do this for nothing.
Got to Believe just started…………..
Ang plug ng stars ng show it is a GV teleserye…………….
Teen version ng BCwMH kaya?…………….
Kung san young amo falls in love with a yaya/kasambahay………
Trendsetter talaga ang BCWMH! More and more teleseryes are now being inspired by its format. This is a good thing, I guess.
If this is true, more GV for us pero I doubt it could beat the kilig of RY and JSM for us…pero baka sa younger gen, kilig na rin!
Happy rin ako pumasok na ang GTB para lumakas ang primetime ng dos. Kasi aminado rin ang taga loob talo sila ng kapuso sa megamanila.
Ginagamit na kaya ng GTB ang formula ng BCWMH???
Evangeline Tasipit@ Monkie Willard……puso mo…relax ka lang at kalma ka lang….. You are so right na namana natin to sa mga Spaniards….I just came back from Spain ( Barcelona) OMG. I thouaght I was in the Phils….early in the morning….eto na may naguumpukan na sa mga under the trees gossiping ( probably) tapos mga donya…nasitaasan ang mga zulo at nagpapaypay….I enjoyed watching them though….so Dona Esmie and Mamang Conchita came frm Spanish time…..OK kana ba?…..I think we will be the one to be surprise …on the proposal…..I think it will be sa romantic place ni nanay Teresita….just guessing!…
Kiss ba sa lips yun?? looks like Maya realised nagkamali siya sa pag-assume!!!
Evangeline TasipitFunny. Funny …funny…Dona Esmie and Mamang Conchita…..you’re both funny….don’t you both worry…you are the same…mganda, mataba at matanda na…he he he
Eman…I still oove you though you spoiled the surprise proposal but….who knows! The surprise will be in our side viewers….How will that be?…..For me…I’m sooo excited….and can’t sleep thinking about it…..Ser Chief is full of surprises!…..BCWMH…..I LUV YOU,…..
Mga Minkies and friends…..I’m waiting for all your reviews…..

Wala lang.. di ako adik
Nyemas…kaloka ang KISS!
Waaaaaaaaaaaaaaaaaaaaaaahhhhhh sis naman kahit nag sabi na kaloka ang KISS, Di pa din ako naging prepared!
Nabigla si Maya pero nakatulis naman ang leps. Reflex na? Waaaaaaaaaaaaaahhh!
MARIKYN GALICINAOSi Emman talaga!!! Hindi lang sya BFF, CNN din sya. Ay naku Emman, kung hindi kalang mabait kay Maya, napugutan ka na ng ulo. Anyway, writers we know that you will still make the proposal a beautiful event, wait nalang kami.
I want to see Maya enjoying her life outside her relationship with SC. Right now her world revolves around work and SC, but it would be nice for her to also have a life with her friends and enjoy just “hanging” out. A healthy relationship is that the parties be able to still maintain other friends outside the relationship. Maintaining close friends is important because it helps a person remain rooted in who they are. It provides balance in the relationship, by giving them some time away from each other, which makes the coming together more happier and joyful.
The greatest thing about friends is that they provide emotional and mental support for the relationship. When times are tough, they are there to lend an ear. When you need to talk, they are there. There are things that we would rather talk to our “same sex” friends than our spouse, because we know that our spouse is not on the same emotional level as we are.
There are times that we cannot be everything to each other. Having friendship (same sex) outside of a relationship can help balance that. Someone that will just listen when you need to vent, someone to do things with that your partner may not necessarily enjoying doing, like…shopping.
So Maya…the next time you get invited by your FA friends, and you have a date with SC…tell him…”Something came up.” LOL!!!! pay back time..
I love you BCWMH!!! I will surely miss you!!!
- Comment
- Share
Uber kilig yung KISS di ba? argghhh!!!!!!!!!!!!!!!!!!!!!!
At parehas nanulis mga nguso nila at may sound ang KISS!!!
hays ang mga labi ko mapupunit na yata sa sobrang ngiti
SABI KO NA, DI MO AKO MATITIIS
HAY NAKU! HANEP MAGPAKILIG!
Long time no see adiks! Sobrang busy lang to comment or reactpero noong nakita ko to : http://www.youtube.com/watch?feature…&v=JNIkAwuGy5Q eh naalis ang pagod ko bigla at naka-type ng di oras dito.
PU na PU lang ang dating. Umarangkada ang delusional mind ko ng di oras. Pansamantala lang na nagover ride ang parallel universe ko bigla. Oo na po di sila pwede alam ko po yon. Sobrang aware po ako at pagbigyan nyo na po. This is all for fun lang. I have my own alternate universe kaya dun pwede sila

Sino b naman ang hindi kikiligin sa taong ito, kahit pa pagsabay sabayin sina Piolo, Lloydie, Echo, Dong, Matteo at iba pa, kakaninin lang sila ni Richard Yap. Speaking voice pa lang ni SC main course na eh. Eh kumakanta pa eh di lalo ng laglag. Lalabas pa dimple nya so hindi nakapagtataka kung macomatose lahat sa kanya. Hindi pa ako nagsisimula sa katawan ha, dimples pa lang yan.
Hindi ako pwede sumigaw right now kaya dinaan ko na lang sa pag-post. Feeling busy lang sa computer hahahahahahahahahaha.
Wanda FvI so love this episode. Halos mapunit ang labi ko kakatawa. My favourites now are DE, Mamang and Dor-Bel. The kitchen scene when DE couldn’t help sharing the ‘secret’ to Manang Fe was so hilarious. But beyond the funny moments, I could really feel the love of both families for Maya and SC. What a great day, indeed! A great way to start the week. I expect The Proposal to be way more than unexpected.
RICHARD YAP, GRABE KA ILANG BESES MO BA AKONG PAPATAYIN ARAW ARAW?
Tapos eto pa yung teaser…sobrang kilig!
SER CHIEF MAAWA KA NAMAN SAMIN OH…PAGAWA KA NG CLONE! Tingnan mo nga naman si Donya Esmeralda at si Don Roberto, hindi mo akalain meron silang nabuong ganyang kaguapo! Sayang di gumawa ng marami!!!
Wahahaha!
Hay naku… ayan na! madudulas na si Emman!
Proposal na ba o movie yung nakita kong pics sa FB kanina?
OO cjm, sangkaterba talaga! ako lang yata ang di tumawa sa mga front act na baklang stand up comedians
Wag naman sana doon please lang!
Ay sus! iwas ka pa dyan, Maya
Eh paano yan, proposal na kasunod
Nag panic siguro sila Nanay na mag-away na naman kayo
Aalis naman na si Coney so wag ka na ma-praning
Winnie R OntiverosYep I feel the same way Wanda. Those are my favorite parts of today’s episode. I am a bit disappointed for Ehman blurting out about the proposal but I am at the same time more happy about the reaction of everyone. It seems everyone is in on Richard and maybe what will happen is that Maya will propose to him instead. ha ha
PROPOSAL
PUTING KUMOT
KASAL
BUNTIS!
GRabeH NamAnnnnnnnnnnnnnnn!!!
Richard IKAW ha!!!
JELLYBEANS na ako!!!!
Pero infernez……….Sarap ulit-ulitin ang TEASER!!!!
ENJOy na ang dalawa sa ganyan eksena ha!!!! Aminin!
May papunas punas pa si Maya.
Ang cute, awkwardness in different level. Juice ko masarap magiging tulog ng mga adiks nito.



NAPAPANGUSO ako sa TEASER!
Natatawa na kinikilig si JOdi!!!
Another Kaboom moment……….LAGOT!
Linda BernardoThe matriarchs do not see eye to eye but when both knew SC’s marriage proposal they were initially shocked. Shock mode turns into extreme excitement, nothing can spoil their day. Dona E cannot keep to herself told Manang Fe. Unfortunately, Dor- bel overheard it. It is now common knowledge at Lim’s household.
Maya is so attuned to SC so when SC said he cannot meet her for dinner she sensed something is going on. She looked worried. Maya asked many questions from SC like reason why he cannot make it, who is he with, where is the meeting. He gave SC the benefit of the doubt . Doris tries to “fish” information from Maya about the discussion on marriage proposal the night before that took SC near midnight to get home. In reality Maya and SC parted ways at 8:45pm. This concern makes Maya and Emman to be at a place where Ms. Abueg and SC are to meet.
SC is up into something she cannot put her finger. But Maya, have faith on SC, it has something to do with what will be put on your finger.
The secret about a marriage proposal is now out even to the person at the receiving end. Emman told Maya the lady they saw is a jeweler and is the best engagement ring designer/ maker in town. Oh what a spoiler.
SC is now in for a surprise. The cat is now out of the bag. How he will deal with the proposal? That is something we all have to wait and see. The element of surprise is now gone.
Moral lesson: A secret is no longer a secret when another person knows about it.
Linda BernardoThe matriarchs do not see eye to eye but when both knew SC’s marriage proposal they were initially shocked. Shock mode turns into extreme excitement, nothing can spoil their day. Dona E cannot keep to herself told Manang Fe. Unfortunately, Dor- bel overheard it. It is now common knowledge at Lim’s household.
Maya is so attuned to SC so when SC said he cannot meet her for dinner she sensed something is going on. She looked worried. Maya asked many questions from SC like reason why he cannot make it, who is he with, where is the meeting. He gave SC the benefit of the doubt . Doris tries to “fish” information from Maya about the discussion on marriage proposal the night before that took SC near midnight to get home. In reality Maya and SC parted ways at 8:45pm. This concern makes Maya and Emman to be at a place where Ms. Abueg and SC are to meet.
SC is up into something she cannot put her finger. But Maya, have faith on SC, it has something to do with what will be put on your finger.
The secret about a marriage proposal is now out even to the person at the receiving end. Emman told Maya the lady they saw is a jeweler and is the best engagement ring designer/ maker in town. Oh what a spoiler.
SC is now in for a surprise. The cat is now out of the bag. How he will deal with the proposal? That is something we all have to wait and see. The element of surprise is now gone.
Moral lesson: A secret is no longer a secret when another person knows about it.

Ang cute lang talaga nang magjowa!
Pati si RYap kinikilig din!
Eh nakakikilig naman talaga!
Corazon TiaAll are so excited for the ” Proposal” lalo na kaming viewers ninyo, sana maging perfect ang lahat….kaya lang di na surprise for Maya kasi malalaman na rin nya from Eman, pero ok na rin yon para di na sya mag-isip , magworry at magselos na may kadate si SC na ibang girl. Hay naku pati ako napapa-isip…..abangan na lang natin ang mga susunod na super kilig at super na nakakaexcite na mga episodes until the ” Wedding”. Thanks a lot BCWMH!!!!!
Balik sa real world of work bukas pero dahil sa teaser naku kahit anong hirap pa ng work gumagaan!
Sabi nga ni DE at Mamang…”walang makakasira ng araw ko!”
Sweet dreams sa ating lahat!
Eeehhh ang sweet ng kiss
Di ko mablame si Maya na bumigay agad kahit upset. WWWWAAAAAAAAAAAAAAAAAAA!! Super sa pasweet si SC! :sweetkiss:
Eeee slightly open yung leps ni SC!!!
HA???!!!
Baka nakapagpraktis na talaga!
SILIPIN ko nga ulit sis yung TEASER!
Slightly open ang leppppssss???!!! bakit ayaw niya i-open kasi???

Pero yung teaser ang ikamamatay kooooooo! Bakeeeeeeeeeeeet!!! May nakanguso at may tunog! Utang na loob. Bakit ang natural!!!
Waaaaaaaaaaaaaaaaaaaaaaaaaahhhhhhhhhhhhhhh!
Halos swak na swak sa leppppppppsss ni Mayabels!
At nakailan kiss na rin na steady lang ang mahal na prinsesa at si RIchard ang nag i-initiate ng KISS!!! LOVE IT!!!
Kaya nga dapat behind closed doors ang shooting! pano ka ba naman maka-emote pag lahat nakatutok sa inyo??? tapos kung may kumakantiyaw pa sa inyo.
Kung yung hug scene nang magjowa sa graduation ni Maya, nakapaligid ang ibang casts na tinutukso silang dalawa pano na kaya nga yung kiss???!!! Nakakconscious talaga sis!
Marunong umasinta si Ricardo!!! juiceko napapadalas ang kiss, nakakaloka na talagaaaa. ano pa pag engaged at mag-asawa na sila! kailangan lagi tayo handa!
Eto pa from youtube naman
May nabasa ako na nasa Resorts World raw ngayon ang BCWMH casts, particularly Maya and Ser Chief, nagte-taping para sa proposal scene nila. Excited much na ako.
WAAAAAAAAAH BAKA CLIFFHANGER SA FRIDAY ASDFGHJKL!!!
Waaaaaaaahhhhh!!! Pano na nga kung SILA na!!!!
May goodnight kISS yan lagi bago matulog!
Matutupad na rin yung KISS sa bedroom at ang PUTING KUMOT ni jeep!!!
Di pa ako nakapunta dun sis!
San dun banda most likely ganapin ang THE PROPOSAL????????
PErfect Place ba sis????
Well, ang activity center nila kasi is parang old European or parang Grand Central station ang dating pero kung plano nila magflash mob. puedeng puede doon!!!
Jusmio juicekoh! pag engaged na sila eh di pwede nang magamit ang couch sa condo pag nangalay na sa loob ng bmw!
Pag married na yung bathtub naman sa master’s bedroom tapos yung bed with puting kumot naaaaaaa!!!!!
Cynch HonradoHilarious, Doris and Sabel are such characters……of course Dona Esmeralda just had to share it with Manang Fe forgetting that they were in the kitchen, and the ripple effect of such sharing gets back to Maya…….as shown in the teaser, Emy’s deduction of the situation is a proposal already, galing mo Emy!
So, tomorrow’s episode will tackle the question of who Richard had a meeting with……..and the Lim household talking about “the proposal” without Richard’s knowledge that the whole gang knows about it already. How will Sir Chief handle and contain it kaya?
Nikki denied that Amiel was Mallows…….but she is not alright as she told Luke that she was just okay……I would hope that this time there will not be any consequence because of your current state of mind – inis nanaman kay Nicolo.
Maya’s advice to Edz to stop thinking about Edward is just right……and Edz’ being amenable to attending the gig of a Capt. Peralta is also alright. I am hoping that Maya will somehow remember Simon’s statement about seeing something at the airport and connects the dots……
bcwmh writers super dooper hanging but thank you pa rin, napatawa pa rin ninyo ako…..
Proposal pa lang, bath tub na agad-agad? Adiiiiiiiiikkkkkkkk !!!!!!
Baka naman HE meant the KISS to be stolen, or some kind of improvisation (with the director’s permission/instruction??). kaya ganun reaction ni girl. in any case, oooooooovvvvvvvveeeeeeeeeeeerrrrrrrrrrrrrrrrr sa pa rin kilig.
Super duper curious na ako kung ano inihanda ng writers para sa atin!!!
Dapat yung OVERWHELMING sa saya, punong-puno ng LOVE
Yung di ko sukat AKALIn
Yung ma-su-SURPRISE tayo!!!
SUSPENSE ito ha!!!
Gustong-gusto ko yan!

Aba eh ngayon ngang wala pa yung proposal ngusuan na ng ngusuan eh.
Mukhang ginaganahan ang writers at si direk sa kiss-kiss ah. and i think richard is liking it
Akala ko pa naman magno-NO si Mayabels,
Parang HINDI ah!
TULOY na TULOY na ang KASAL!
Kay Amoroh gesssh…. SPELL S P O I L E R!!!!! but this episode is soooo funny special sabel and doris..when they have to shout SILENTLY…. WELL.. i know the creative team has something more exciting than the spoiler…hahahahah…ano ba ito.??
tulog na ako. i can’ think sensibly coz am sleepy…..HAPPY MONDAY EVERYONE!
Gandang gabi! sorry absent ako kanina!
Present ako ngayon kasi nawindang ako sa kiss sa teaser…
Waaaaaaaaaaaaaaaaaaaaaaaaaahhhhhhhhhhhhhhhhhhhhhhhhhhh
Anyare ba dun? the kiss is meant for the lips pero umiwas si maya so napunta sa cheeks or sa lips pa rin… nirape ko na yung replay button pero kasi kiligmuch kaya hindi ako maka-concentrate sa pagtingin!
Di mawawala yung YAKAP habang natutulog!
Sa wakas after 6 years, magkakaroon na rin ng katabi sa bed si Ricardo!
Sa kanan kaya siya o kaliwa ng kama
E di ba, may nakasanayan na sila na pwesto sa bed… richard sa left side at maya sa right side ng bed…
Maka hindi ba si Maya kung proposal pa lang ni SC engrande na???? di naman siya siguro kagaya nung pinost dito ng isang sis natin na hinampas ang lalaki sa kahihiyan!!!
At DYAN SIGURO ma-WI-WITNESS NATIN YUNG
VERY FIRST……..
P.A.S.S.I.O.N.A.T.E……..KISS ni Mayabels at Ser CHief!!!
Wala naman sigurong problema kay madame kasi sabi nya noon, ok lang…”if the story calls for it”…
Mga kabisyu sabay sabay nating isigaw…THE STORY CALLS FOR IT!!!
Waaaaaaaaaaaaaahhhhhhhhhhhhh. Napalunok ako sa passionate. Bilis naaaaaaa!!!!!!
Naexcite ako sa passionate!!!! wahhhhhhhhhh!!!
Kayanin ko kaya ang proposal na yan? Kasi sa teaser pa lang ng kiss, bumubuhol na ang intestines ko pano pa kung proposal na at may passionate kiss na nga… OMG!!!… baka di na matanggal ang buhol ng intestines ko…at di kayanin ng lungs ko… di lang pala ang bawal na pagtawid ang nakamamatay… pati pala ang BCWMH… nakamamatay sa sobrang kilig…
Pagbigyan naman tayo ng writers at producers!
Wag naman panay NGUSOHAN na lang!
Although nakakakilig talaga!
Talagang may isang passionate kiss that MUST happen either after sagutin ni Maya si CHard sa proposal o sa WEDDING!

Silip ulit sa teaser for the nth time with matching pause ng konti balik at play sa kiss part…
Pasigaw ulit…
Waaaaaaaaaaaaaaaaaaaaaahhhhhhhhhhhhhhhhhhhhhhhhhh
Hindi ako makasigaw kasi dito, my sister is in front of me, studying for an exam at masama na tingin sa akin kasi kanina pa mapupunit yung labi ko sa kaka-smile at ngisi dito…
Nakakainis sa kilig! comatose na sa teaser, paano pa bukas at sa mga susunod pa???
Ang perfect kasi eh, gusto ko yung medyo may LQ, selos mode si Maya, nagpapakyut si SC, ang spontaneous ng galaw (read: parang hindi inaarte! ) may tunog yung kiss!
Ah bashtaaaaaaaaa!
Kay AmorGood morning world…am awake….or just woke up..and I can’t get over with the “cat out in the bag”..any way…I guess it’s gonna be SER CHIEF who will be surprised…..coz he is the only person who DOES NOT KNOW that every body knows already about the proposal. and He still thinks that it’s a secret……sounds EXCITING nag eh..and I just can’t help myslef from smiling…..the earliest day of proposal this week will be friday . coz I saw in one of the teasers that SC will still go to Alex’s grave and tell her that He is going to marry again…..so marami pa tayong exciting scenes na aabangan..and in between will be the MTV of luke and nicolo… so…sit back and relax….savor the moments as this show is near the home run soon…
Hinahabol habol ni Ricardo ang labi ni Mayabels tapos tapos si Maya ano ba di ba dapat ayaw niya, bakit siya nakanguso? Medyodimakausad:
Sa susunod BTS na nang THE WEDDING ang makikita natin
Sana OPEN to the fans ang taping ng wedding!
Buti hindi DILAT si Maya this time.
Hindi naman siya dilat nung last eh! Sapul na spul talaga ni SC iyong lips. Okay paulit ulit na ako
Speaking of kiss here and there na yan…
Detailed ba ang script nila??
I mean, kapag sundo sa airport or sa condo and pag-bye or good night, minsan kasi hug lang, minsan si Maya ang kiss sa cheeks, minsan si SC ang mag-kiss… indicated ba yun sa script everytime???
My favorite words from you guys tonight:
SPONTANEOUS & NATURAL
Kaya sapul na sapul kasi kabisado na nya! Kaya naging spontaneous and natural na
Totoo ngang practice makes perfect
#UmaartePaBa
.At nakabalik ako! Grabe, ang bilis nyo naman mga sis.
Needed rin to be back kasi na-BV ako sa nanay ko. Sinabi ko kasi sa kanya na nabalitaan ko na sa October na ata matatapos ang favorite nyang teleserye. Sabi nya, buti naman daw yun unlike BCWMH na ineextend pa e nakakasawa na. (Wag ka, pag nanunuod naman, kinikilig!) Got used to nega comments naman about the show pero iba talaga pag galing sa kakilala mo. O well, enough of the BV. Kaya nga love ko tong thread na ito e kasi I can pour out my kaadikan on the show.
Haay… Pero with the kiss ng magjowa… Walang makakasira ng araw ko!
Curious talaga ako… or may script pa ba on these scenes??
(kinakabahan na ako sa mga tanong ko)
wala na yata eh. parang ieexplain lang ni direk ano gusto nyang mangyari tapos bahala na sila mag-execute. sariling diskarte na nila yung mga ginagawa nila.
#MasKinakabahanAkoSaSagotKo#
#BitayNaItoForSure#
Palagay ko ang sabi lang sa kanila ni Direk, “Do whatever comes to both of you naturally”
#LumakasAngLoobKo#
#WalangDeathPenaltySaPinas#
Pansin ko lang, parang sanay na sanay na si SC magkiss kay Maya, parang way of life na nya.

Kahit nga si Jodi, sis, hindi kinakaya ang kilig sa mga tingin at pahalik-halik ng kamay ni RY. Kitang-kita naman sa mga videos ng shows nila.
Kaya di ako naniwala na pusong bato si JSM sa charm ni RY. Kung tayo halos di mapakali sa kilig, eh nanonood lang tayo sa TV, siya pa kaya na up close and personal. hindi kaya siya ma attract sa sex appeal, kagwapuhan at kabaitan ni RY?? Naku, kita niyo naman ang epekto ni RY sa mga milliong mga babae!!
Gusto ko sana mag-comment…. emoticon na lang
#playingSafeDin
Ron &Amp; Priscilla SwitzerMY GOLLY! EMANNNN! YOU’VE GOT A BIGGGGG MOUTH!!! IT’S NOT YOUR BUSINESS TO TELL MAYA, YOU KNOW!!!!
May nakita ako sa FB noon na BTS pic nila during the lunch na sinet ni DR. HH ang magjowa. Pero mukhang di naka-roll ang camera noon. Sabi sa FB, cut na raw, HH pa rin. Nadadala na raw. Mukha nga.
#BatasNaBaAngAntiCyberCrimeBill
Kaya pala genuine ang dating ng kaboom moments; ‘follow your heart’ lang ang peg nila.
#BiglaAkongTumapang#
#WalaNamanPalangDeathPenaltyEh#


Slowmo
Etong mga ganitong slowmo talaga ang hinihintay ko eh. Iba ang linamnam. Thankie, sis lastsong
#ItoAngDahilan#
Kitang-kita ang pagpikit ni Maya nung malapit ng dumampi ang mga labi ni SC. Internalization of a Realization.
#ItoAngDahilanNgKabaliwan#
Yan! Way of life! Kanina ko pa inaapuhap yang mga salitang yan sa kasulok sulukan ng bumbunan ko. Naharangan ng kilig pati utak ko
Thank you sis, na-bullseye mo!
#SanayNaDinSiMayaSumaloNgKiss#
#WayOfLifeNaNilaYun#
#IsThereALawyerInTheHouse#
#MightBeNeedingOneSoon#
Alam mo sis yung first few weeks admittedly malakas ang dating nung show ni pards, then di na ganun ka-ingay ngayon………..ang bilis!
gusto ko naman ang kuteff
Agree. After mabuking ng character ni Carla Abellana yung characters ng TomDen, medyo humupa yung bruhaha about the show (though doing good pa rin naman sila).
Kaya nga hanga ako sa BCWMH e. Even though maraming mga bumps silang na-encounter, they were generally able to sustain the hype and the solid fanbase
Madalas siguro mangyari ang ganito
#NakaTROangCyberCrimeBill#
Malamang. Biruin mo naman more than a year na sila magkasama, day in and day out. Not to mention their mall shows, tv guestings, & out-of-the-country shows.
#SoItsNotYetALaw#
Who’s liking it…Richard Yap or Richard Lim?
Who’s liking it?
Maya Lim/Jodi Sta. MariYAP.
#PakilalaMoKoSaLawyerMoTalilai#
Nature will always have its way. Di pwede pigilin.
#LawNaPeroNakaTROangImplementation#
Class suit na ito! Anong kaso natin? Multiple counts of display of addiction?
#SaMuntiAngBagsakNatinHindiSaRehab
Ngayon lang mapupuno ang Munti ng mga preso na naka-nguso
#BakaPwedengSaMentalNaLang#
#YungIbaNgaSaStLukesEh#
Nature will always have its way. Di pwede pigilin.
#LawNaPeroNakaTROangImplementation#
…Exactly. Kung tayo nga na nakikinood lang GIGIL and KILIG to the maximum level, at nakikinguso pa, sila pa kaya?
#they’reonlyhumanyouknow
#togetherness #familiarity #chemistry
Jo EI wonder what the creative team is cooking to make The Proposal memorable and interesting now that the element of surprise for Maya is gone. Ser Chief will be the one who will be surprised. Everybody in the Lim and delaRosa, (except for Kute and Cho) family know. I think it’s better that Maya knows that Ser Chief is meeting the jeweler to procure her engagement ring, than her wondering who the woman is with Ser Chief. At least she will not have feelings of insecurity and hurt, in the light of just what happened to Edz. Even if Maya trusts Ser Chief, there is still that feeling of anxiety and uneasiness, until she hears from him that he acknowledges meeting with the woman for whatever reason.
I am so looking forward for The Proposal.
Great job BCWMH team.
Rachiel Dimeawww.. bkit gnun.. wala n un essence ng surprise.. haist.. masisira lahat ng plano ni sir chief… haist..sna magwan ng style ng writers to…
So, this only proves na yung panguso-nguso ni SC kay Maya ay natural… Is that part of the 60% he said sa CLP?
#LagotNa#
Dati pa yung 60%. Baka nasa 90% na ngayon.
#PatayNa#
Kaloka ang mga hashtags!
#hanapngthebestlawyerintown
Chief justice na ang kailangan
Minsan kahit yung mga ngiti, biglang tawa, asaran. ……richard yap na richard yap base sa interviews
Way of life na sakin ang bcwmh/maya & ser chief. kahit iextend pa ng iextend, eventually matatapos din. di ko yata kaya. mami-miss ko talaga sila ng sobra. napapanood ko lang sila nyan ha, hindi ko sila nakakasama ng personal.
#EhYungDalawaKaya#
#TuloyTuloyAngSOCO#
Iba talaga ang BCWMH. Saan ka nakakita ng Nanay na supportive sa kaadikan ng anak nya. Dito lang yun.
At ataters pa si mudra sa kasal nila SC at Maya. I love you #NanayNiMartin#
Buti pa ang #NanayNiMartin# E ang nanay ko…
#SawaNaRawKunosaBCWMH#
#PeroKinikiligPaRinPagNakapanuod#
#SubaybayAngMgaRaketNiRichardYap#
…si mareng angelina jodi ba kamo?
#thenearnessofyou
at si brad chief.
Galit na galit ako kay mareng angie noon kasi team frendz ghel ako – syempre underdog sya.
Pero bakit ngayon di na ako galit?
#closetoyou#
Mas feel ko yung si maya magtilt din yung head to return the kiss like yung sa garden sa mansyon!
Kung kelan si Jodz nagkiss na talaga si Richard naman yung pigil! hayzzzz……..
Sis jam, actually, tame pa nga tayo sa pex ng lagay na ito e. If you’ll read lang sa ibang bahay ng mga adiks like us, hay naku, grabe! (though haven talaga sya for fans). Ang layo ng tinatakbo ng isip nila. Minsan rin may bahid ng katotohanan pero mas lantad nilang pinag-uusapan dun.
Pero ang saya naman talaga ng buhay adik e!
I agree with you sis cyberowl….napaka tame pa natin dito sa class compared to the other balur ng mha adiks…
2319 days agoISABELITA GUIRIBAAs always sabi nga ni SC “Nothing goes to plan pagdating sa kanila”.Baka nga the whole Lim family will make the proposal to Maya so it would be a surprised for both.
Kasi nga mga fans nila tayo they should understand na we only fantasize about the possibilities….kung ano ang pwede mangyari….
#ditayobadFANlngpotayo
Yes na yes. Yun ang nakapagpapasaya sa tin eh – the possibilities.
#YeheyHindiAkoBad#
I am a lurker no more. Love BCWMH at dahil dito andami kong naughty wishes like sana, sana…
….totoong me something between kay JSM and Ry kahit mutual admiration and fondness ( though not necessarily wishing them na maging sila ) dahil di ba sabi nga ng malaman ni SC na me crush sa kanya si Maya e Normal lang yun.
…that they do their romantic scenes with more passion ( parang si Dolphy and Nida sa John and Marsha ), yung natural ang lambingan with no reservations dahil me mga bantay.
…that Jodi would always allow Chenes to hold her hand longer and get closer when they sing at shows kasi notice ko minsan aloof si Jodi dahil siguro ilang or kinoconsider ang feelings ng mga bantay.
…pwede bang mas mahabang kissing scene like yung peg ng Bart and Sophia sa 100 days.
ay naku more wishes dahil they should take these into consideration dahil what got us closer to the show is the romantic aura between SC and Maya.
…pwede po ba tigil muna si VG ng pagparamdam kasi di ko talaga sya feel for Jodi. Sorry Jodi. love na love kita.Alam kong wala kaming pakielam sa real life love mo but you deserve someone better. My apologies.That’s all for now. Let’s continue to raise the bar for this show.
At napa unlurk ka na rin!
Lahat ng laman ng listahan mo sis ay ang mga sentiments din ng mga kapwa FA’s (forever adiks)
Another wishful thinking that allow me to share…in one of TFC chats with Jodi and Richard , the latter mentioned something like he wishes to do a movie like Somewhere In Time, that was a movie from the mid 80’s and indeed a romantic one , sana after BCWMH e makagawa sila ng ganyang movie. Tapos diretso na ako sa ospital dahil for sure i would ran out of breath sa kiligness.For a man like Richard Yap to mention that movie e it only confirms that he is also romantic.

———————————————————————–
FLASHBACK<<<<<<< REWIND
VOLUME 25
293 Date Aired: August 27, 2013….Si Emman, madudulas. Will this spoil Ser Chief’s plan?
Talagang sinadya ni Maya yung place na sinabi ni SC kung saan ang meeting at di nga nagkamali dumating si SC with girl at nakita ni Emman at Maya.
Sabi ni Emman kakalbuhin daw nya yung girl hahaha!
Ayun umuwi silang inis ang Maya at nahalata ni NT na may kaganapan.
Ask ni Ms. Abueg si SC to describe Maya to help SC for the modifications ng ring para naayon sa personality ni Maya.
Ang sweet lang ng mga descriptions ni SC kay Maya! Sweet, caring, sentimental etc di ko masabi sakto pagkakasunod basta ganun hahah!
Then after nila usap sabi ni SC na kung ok lang n di na sya samahan sa parking kasi bibili pa ata ng desserts for Maya.

Then ask nya si SC kung is it different daw ba compared sa 1st time na nagpakasal sya…non verbatim ito ha.
At hindi ko na syado naintindihan basta sabi nya the feeling ng kaba is still there.
Tumawag ang receptionist at nsa condo si SC. Talagang atat na si Maya na harapin si SC…sinalubong talaga sa pinto with Mamang, NT at Emman na kinakabahan.
Cristy SantosMinsan hindi talaga nagbu-bunga ng maganda yung pagka “chismosa” ng mga tao, tulad ng ginawa nila Sabel and Doris. Nagka idea tuloy sila Maya and Emman na mag “spy” kay Sir Chief. That’s not good. Kung makikita mo si Sir Chief na may kausap nga na babae, siempre masasaktan ka di ba Maya? pero hindi mo naman alam ang “the truth behind it”. Oh well! it is very common naman na nangyayari talaga in real life. And abangan na lang ang mga “next episodes”. :)) :))
Iniwan si SC at Maya at pumasok yung 3 sa room.
Hindi rin talagang na confront ni Maya si SC at pinanindigan ni SC na si Ryan ang ka meeting nya. Mukhang di naman ganun kagalit si Maya kasi nangiti nga nung nakawan ng halik ni SC…kung ano yung nasa teaser yun ang pinakita.
Pinakita rin pala ni Emman kay NT at Mamang yung girl sa magazine pero hindi naman sinabi ni NT na tungkol sa proposal ang meeting. Mukhang later pa sasabihin after mag usap sina Maya at SC.
Nag uusap Luke and Nikki di raw nila inakala na darating ang time na mag aasawa uli dad nila na kailangan daw ng dad nila ng katuwang sa buhay.
Winnie R OntiverosMaya stands outside the gate of the mansion thinking about what Doris said that Richard came home at midnight last night. They thought he came from her house. She is suspicious because Richard left before 9 PM last night claiming he is tired from working all day. Maya was thinking out loud about Richard suddenly canceling their dinner date tonight to apparently meet with Atty. Ryan at the Moons Brew and Pastries. Ehman sounded off and said that place is good. Maya said she heard they have good dessert. She and Ehman decided to stop by and check out the place. (Uh oh…Maya is going to do her Ninja move.)
Nanay Teresita calls up Kute to tell her about Richard’s plan to propose. (Uh oh, everyone knows now including the San Nicolas folks. I could see Bugoy eaves dropping in the background and Leno as well. I am sure the news will spread like wildfire, and in no time, to the entire town.) She was excited about it. She wants to plan something in San Nicolas for the engagement. She told NT and Mamang that she expects Richard to come and ask for Maya’s hand in marriage formally in San Nicolas. Nanay Teresita agreed. Kute wants to plan for it in the event Maya says yes. Mamang said that she is sure Maya is going to accept the proposal. Kute started to worry because she said Maya has high expectations when it comes to proposals. (Don’t you worry Kute, Richard will figure something out that is going to make Maya feel like your mother when your father proposed. After all, he is Ser Chief.) Mamang agreed and sarcastically said it is because she heard about Arturo (Nanay Teresita’s husband) and his proposal to NT. NT reacted to what Mamang said.
At the mansion, Nikki was going through the slide presentation she sort of put together for Nicolo’s music video. She had the words to Katharine McPhee’s Terrified and the guitar chords to it on her laptop. (This is actually one of my most favorite songs of Katharine McPhee from her latest album. Link includes lyrics http://www.slack-time.com/music-video-9177-Katharine-McPhee-Terrified ) She sigh’s and thinks that all the work she’s done is now going to waste. (aaawww I am sad too Nikki) Luke knocks at the door and walks in. He asks Nikki her real reason why she backed out of helping Nicolo. Nikki told him that she sensed that Cheska is one of those “maarte” girls and he knows she clashes with those types of girls like Aira. Nikki said she knows that Nicolo likes Cheska and she is just trying to be cautious. She knows that sometimes even when she does not mean it, she causes trouble. She didn’t want to stand in Nicolo’s way. (Good answer Nikki I am proud of you.) Luke understands so he asked her if she wants to join him in his music video. (Luke you are such a sweet brother.) Nikki said no because it looks like Ange and Cheska are really close friends and again she doesn’t want to get in the way. She did promise her brother that she would help him practice from home. Luke said it’s a deal.
Maya and Ehman get to Moons Brew and Pastries. They sort of look around but do not find Richard or Atty. Ryan. Ehman tells her that maybe they have already came and gone. Maya admits she is feeling guilty about spying on Richard. She said Richard is a good guy and he won’t do anything bad like Edward did to Edz. Maya wanted to just hurry up and leave before Richard sees them there. When they started to leave, Ehman spotted Richard and Ms Abueg walking towards the tables. Ehman cautions Maya not to look. He pulls her toward the Sale banner and hid behind it. (Now Maya is agent 007 with her sidekick Ehman ha ha) Maya and Ehman see Richard help Ms Abueg to a chair and he sits in front of her on the small table. Ehman asks who is this woman he is with? Maya said she doesn’t know. Ehman wants to go and attack her (ha ha) but Maya pulls his Tshirt to put him back in place. They continue to spy on them. Ehman asks Maya what are they going to do? Maya said she doesn’t know. Ehman tells her what they are doing is not right and that they should leave. Maya was confused and upset but agreed to leave. (I don’t blame you Maya, I am jealous myself ha ha)
Winnie R OntiverosRichard and Ms Abueg talk about the engagement ring. She asks Richard if he already has the modification that he wants? Richard said yes but he still needs her opinion. So she asked him to describe Maya to her. Richard suddenly has this glow about him when he thought of Maya. He told her that Maya is a flight attendant. “She is very simple and would probably react if I gave her something extravagant. She is caring. She likes doing things for other people. She likes to cook for us even though she is a terrible cook.” They both laugh. Richard apologizes and wondered if that information mattered? Ms Abueg said yes it does. Richard continued. “She is playful and funny. Sweet. She can be very stubborn at times. She’s unpredictable and very sentimental. She likes keeping little things for remembrance even before we became an item.” Ms Abueg heard enough and suggested a ring that she thinks suits Maya. She shows him a picture similar to what he chose but with additional details that Maya might like. Richard smiles in agreement. (Aaawww Richard you are so sweet)
In the cab, Maya is so upset after her ninja 007 mode. She tells Ehman that last night he was in a hurry to leave and then tonight…. Maya couldn’t finish her sentence. She asks why does he need to lie? It is what bothers her the most. She said that it is making Richard look guiltier. Ehman thought the girl looks familiar. Maya said maybe she is a model (Maya you hit the nail on the head. She is indeed ha ha) Ehman said he doesn’t care. He wants to shave her head off. (ha ha watch out Ms Abueg, Ehman is out to get you for his roommie ha ha) “Why don’t you just ask him straight out?” Ehman said. Maya thought about it for a moment and then opened her purse for her phone. She was about to call him when she stopped herself. She didn’t want to act on impulse. She lets out a big sigh. Ehman asks her if she didn’t want to know? Maya said she wants him to say it in front of her and not over the phone. (I have to say, with Maya being upset like she is, I am so glad that Ehman is there to help her through this. He is her sounding board…her shoulder to cry on…Thankee Ehmmy.)
At the condo, Nanay T and Mamang talk about the proposal. Mamang wonders how Richard is going to do it? She thought of an aerial banner with a message that says “Will You Marry Me?” Then Mamang thought that Richard might propose to Maya during one of her flights. Nanay T said that Richard didn’t have to think of gimmicks to do it. It can just be simple and sincere. Mamang asked Nanay T if Arturo’s proposal to her is sincere? How is that sincere she asked? Arturo left her after all. (Wow Mamang you sure are a meanie. Rub it in why don’t you? Maybe Ehman needs to shave you bald ha ha ) At the mansion, everyone was in a frenzy. DE was in the midst of it. She is looking at a bridal catalog and showing Manang Fe the intricate lace designs that she wanted Richard to look at so he could model the ring to match it. Nikki tells her that she has ideas on how Richard should propose like what she saw on YT about this guy that proposed in front of a lot of people and there were cameras all around to record the event. (That reminds me I am still going to watch the YT link that How Wasabi posted. Pramis!) DE thought that sounded romantic but she thought Richard being conservative might not go for it. (True DE. You know your son well.) She proceeds to tell them the story of how DR proposed to her. He took her to a Chinese restaurant and at the end of dinner; he picked up the wrong fortune cookie and ended up proposing to himself. DR came to the room and realized that she has told everyone about Richard’s plan. He warned her that she was supposed to keep that a secret. (Yeah from now on I will call you Loose Lip Esmeralda.) She apologized and said she didn’t mean to and in fairness, the kids already knew. DR reminded her that a proposal is private and should only be between two people. (Ummm DR that is soooo “old school”. )
Nasagap ko sa ibon na binuking na ni Emman ang proposal tulaley ang Maya.
Then nahagip ko pa ng kaunti ang teaser, masaya si Maya pero handa na raw ba sya? kausap nya si NT.
Then tumawag si SC, mukhang ok na raw si Maya then last night. Tapos niyaya mag dinner. Smile si Maya while si NT, Mamang at Emman sa background eh kung ano ano ng scenario ang binibigay ka Maya kung saan posible nakalagay ang singsing hahaha!
Yung fourth gap… ayun nga Nikki and Luke were talking about how lucky they are kasi yung daddy nila nagfofall para sa mga right persons!
Tapos sa condo naman ni Emman… ayun tampo mode pa din si Maya kasi hindi daw umamin si Ser Chief, pinanindigan na si Atty Ryan ang kasama eh sabi nila Mamang wag daw siyang OA, tinatawanan nila si Maya. Sabi ni Emman minsan lang naman daw. Sabi ni Maya hindi daw dapat ganun kaya daw maraming babae ang naloloko eh. Tapos yun tatanungin daw nya uli si SC, ayun na… pinakita na ni Emman ang magazine at sinabing magpopropose na si SC!
Nasabi rin nila na lucky daw ang dad nila kasi he’s meeting the right people…na sana sila rin daw….pag na inlove din sila…parang ganyan ang recall ko hahaha!
Tthen parang sabi ni Nikki na di sya maiinlove ata or kung ano basta niloko sya ni Luke na…baka pag ikaw na inlove! …..di ko na gets ahhaha!
Cristy SantosLuke were right! He understand his father’s situation, if the time comes that they will have their own families and their Dad will not be alone. Somebody will takes care and love their Dad and they were so lucky too, that their Dad found the right person.
Tapos yung teaser!!! HAHAHAHAHAHAAHHAHAA
Ayun si Maya kinkabahan na natatakot pero ang saya daw nya at masarap pakinggan yung proposal. Tapos tumawag si SC kinakamusta sya, ok lang daw si Maya sabi ni SC hindi na daw ba upset, ok na daw siya ngayon. Tapos nagyaya magdinner, ayun napapraning silang lahat na dun na magpopropose si SC! Mukhang laptrep yung dinner na yun!
Bongga! kaya pala good mood na si Maya kanina di rin natiis si SC kinilig pa rin
sabi nga ni boss Gabby…pag may kasama daw ba, nambabae na, di ba pwede na preparation sa wedding. WAGAS! normal lang kabahan, Maya pero kaya nyo yan
road runner na sa bilis si SC!
As for today’s episode, what can I say???…BCWMH keeps getting better and better!!! It’s really a game changer for all teleseryes, for contrary to the usual trend na nagsasawa na ang ibang viewers after a while, it keeps getting kiliger and kiliger, more exciting in other words. The fever is back wherein, I couldn’t wait or even sleep, hoping that I could watch already the next episode!!!
Willand CebedoLOVE VS JEALOUSY
what a spectacular performance from maya as a woman who is jealous. she is showing her restrain and believe it
or not, not so many women can handle it. ehman himself could hardly control that he would grab the woman’s hair.
(what a nice long legged creature that sir chief is talking to. everybody can notice that perfect legs like a
model not a jeweler. legs can sometimes make men crazy aside from frog legs.)
i would not be surprised since most of all the minkies are coming from planet venus. the lady love.
the monkies are clueless regarding love so they indeed buy the copy from any books they can find FOR THE DUMMIES.
how maya handle it is the best thing that ever have happened since the disappointing episode with donya
esmeralda and donya conchita. the shriek of excitement coming from maya would bring us to the times
when she was invited by sir chief for the first meeting and the balut eating to boost their appetite of love.
maya as she loves the sir chief so dearly that seeing with the legged woman would make her cry. but she did not.
she just thought of giving sir chief a coffee that even the obama would dislike. after noticing that sir chief
could not stomach the coffee, behind her mind, she was thinking: “good for him, good that it is not poison.”
there is no real data or evidence how many husbands are being poisoned because of jealousy.
my advice is “don’t drink or eat anything that your wife has given to you if she is in a jealous mood.
so far my disappointments turn to excitments, how the writers resurrect the bad episode to a better one.
i am sure my next topic would be “love and marriage” also sang by frank sinatra.


Ang mga tingin ni Maya nakaka tense haha at halatang walang halong pagmamahal yun kape! Ninerbyosin si Ricardo sa sobrang tapang nun timplang kape!
Can’t wait for the grand proposal!!!
- Ang sarap maging friend ni Emman!!! ‘kahit model pa sya, kakalbuhin ko sya’
- I like how everyone in the Lim household are all so excited sa upcoming wedding, e hindi pa nga nag-propose kwela din that DE make kwento pa of how DR propose to her.
- Tama din naman si Mamang, ‘kesa mag-away pa yung dalawa, di ba?
Zel MOF LOVE AND JEALOUSY
Seeing SC with another woman with her own eyes, brought mixed emotions, insecurity, anxiety and jealousy for the very first time. They say jealousy is like salt in food… a little can enhance the savor, but too much can spoil the pleasure and under certain circumstances, can be threatening to the relationship. In any relationship, there must be jealousy to symbolize love; and, there must be love symbolized by jealousy. Jealousy is important as a flavor of love, to show that we care for we won’t be jealous if we do not love, and vice versa. Healthy jealousy is normal but excessively, it can trigger illogical reasoning, paving way to ill feelings, ill thoughts creating chaos, disorder and conflicts and can very well harm any relationship. It can cause a lot of stress to both partners, anxiety and even affect the well-being let alone health. Feeling of discomfort in a relationship trickles down to difficulty in communicating and expressing each other’s feelings, thoughts, and other gamut of emotions.
Maya just needed to remind herself that she had trusted her Mahal na Hari for so long. Time and again he had proven his love to her… his loyalty… he had been an open book as far as his love for her was concerned. She should remember that many women had eyes for her SC and tried their hardest for his attention let alone his affection – Not even the likes of women in his circle could get him to look the other way- not even the sexy Stephanie, the intellect Atty. Gie, the socialite Catherine and all those girls at the Hangar Launch for SC had only eyes for one and only one, HER. And he even went beyond proving his love as he stood by her side when the going got tough, he was there comforting her, loving her more when the kids did not initially accept their relationship, he had been steadfast, he fought for his love, he fought for their relationship proving to the kids that she was the one for him and she would be the only one who will ever make him happy. He fought and he fought the hardest proving to the kids just how valuable she was and still is not only to him but most especially to them. When the situation had been settled and acceptance had been granted, he took that opportunity to announce, better yet introduced to his world… the very woman who captured his heart and with so much pride introduced her to the business loop… to the world he revolved in, to his friends, his business affiliates and his staff.
And when the going got tougher when his parents initially doubted her, there he was again at the forefront fighting the hardest… proving his parents wrong and turning them around, opening their eyes so they also see what he saw. And when it mattered the most, he humbled himself again, made himself vulnerable in front of everybody, wooing her, serenading her, doing stuff that will make her happy and yet again, conservative and valuing his privacy the most, he opened up to everyone as he humbly apologized and said his sorry for everyone to witness just how sorry he had been for hurting his most precious beloved.
And not to forget in the not so distant past how he had defended his love for her in front of those she held so close to her heart – her Nanay, Mamang and Kute. For he humbled himself in front of her family just to prove that he was worthy of her love and that he made a promise that he had kept all this time… he promised to love and cherish her… a promise of his undying love and a love that will be for keeps. He had never swayed nor deviated from that promise then, nor will he ever waver now.
She trusted him then, all the more should she trust him now. Rephrasing it, she had trusted him with all her heart then, she should have faith in him now… more than ever. And let love reign, after all love cures – both the ones who give it and the ones who receive it.
In the end, love will prevail… it will exceed even the highest of expectations. And just when it’s about to falter, it still will hold on… it may be shaken but true love never breaks… it may face rough times, yet it embraces all for that is where it gets all the strength to grow… it fights to no end, in the darkest of nights, always holding to that light of hope for we may give up on love, but love will never really give up on us. Love… takes a lot of believing… a whole lot more of trust… and that immeasurable faith.
Winnie R OntiverosWell Zel how wonderful your mind flew today. You seemed so inspired and I don’t blame you, after all the subject matter makes us all inspired. The love story of Maya and Richard. You are absolutely right about Maya should be trusting him but the sequence of events led her to have that temporary doubt in her mind after all she proved that he lied to her. Whatever his reasons were and even if she isn’t jealous, the fact that he told her two fibs and then caught him in the act is sort of hard to put off. She is also privy to the story of Edz and Edward who she trusted and not one doubt and all along he was cheating on her. Maya is but only human. Like she said why does he have to lie to her. It makes him look guilty. Her words proved she wanted to believe in him. She wants to trust him. But in the end, all is well. She is now in a happy place just waiting for that time when Richard will seal the deal and put that ring on her finger. The time is near and we are all along for the ride. How exciting it truly is.
Sis Thankee again for your wonderful POV. I love reading them and I love that you never get tired to keep on putting out such well thought of summation of our story. Till tomorrow. Luv yah much.

- So sweet and heartwarming yung mga good words ni SC about Maya and also how he still feels excited and nervous sa gagawin nyang proposal
- Talagang si mamang ang nag-welcome kay SC dun sa condo, with matching hawak pa sa biceps.
Zel MSis Win, Maya is in a happy place, so are we ha ha ha.. Yes, I do agree that Ed0z’ breakup with Edward may just be one of the triggers for Maya’s jealousy and of course Sc’s out of character canceling on their dates and leaving so abruptly, so unlike him, so his Mahal na Princesa suspected something’s not so right, just yes she’s just but human… and she has all the right to feel that way too… it’s actually cute her being jealous and all… ha ha ha…
– I love the tinginan of Emman, NT, and mamang para sa connivance nilang spa session.
– Luke & Nikki’s conversation — hugs and kisses to both of them.
– I super love Maya’s silent monologue while SC is giving her cake si Maya naman
and of course that kiss, talagang hindi naitago ng prinsesa ang kilig.
—- the teaser: Manang Fe and SC … so touching! Excited much na talaga sa mga susunod na kabanata!!
Ang kiss —-aaaayyyiiiieeee!!! Alam na alam na ni SC aano paamuhin ang Atty niya…. !
I forgot to mention pala the kiligmuch ‘I love you’
And… may nakapansin ba or bingi ba ako??? Nung sinabi ni SC na magpapalam sya — ang sabi nya kay mamang at Teresita??? First name basis sa future mother-in-law?? Or bingi lang ako????
Theresa Villa
Wow!! Lots of ideas about the proposal ..
I have been a big fan of bcwmh since the beginning.. I love reading the comments.. Very insightful.. I actually never missed an episode.. I even watched it online in between flights.. Thank god for airport wifi..
I think the parents were giving us a clues the proposal.. According to nanay Teresita, it’s going to be simple and sincere.. According to mamang, it’s going to have a written question of “will you marry me?”. According to Dona Esmeralda, it will be private.. And according to Don Roberto, the proposal will be between two persons ( and a half, maybe)..
And it’s going to happen when we least expect it..
Where??
not at Arturo and Teresita’s most romantic place? According to maya,Every time nandun sila palagi sila nag aaway.. Although that’s the place where they became bf/gf but nothing else..PUS? Insensitive naman si Richard Kung dun siya magpropose.. That was the place where he and Alex met.. Although, dito rin niya sinabi Kay maya na they will create their own memories..restaurant?? It’s so over according to rafi..
I could only think of one place na puwede mangyari ang proposal.. Where we had witnessed most of the memorable scenes in this show.. Kung saan nag umpisa ang kuwento ng mahal na hari at ng mahal na prinsesa.. And maybe, maya can finally finish answering yung mga question sa slam book.. And the most important question..
And I think, Abby will have the privilege of witnessing the proposal. Coz, she had been there from the beginning..
Kaloka! Nagmana pala si SC sa papa niya na pumapalpak ang mga pinaplano. Di kaya mapalpak naman ulit kung ano ang planong pagpropose ni SC?
Ang mga tingin ni Maya nakaka tense haha at halatang walang halong pagmamahal yun kape! Ninerbyosin si Ricardo sa sobrang tapang nun timplang kape!
Yun kiss!!! May tunog!! Hindi pa diniretcho sa lips eh sa gilid pa!Parang wala sa script? Kung maka react si Maya.
Ang confidence level ni Ser Chief ibang klase! Kung sabagay ikaw ba naman titigan at ngitian ng ganyan tas labas dimples hindi ka ba matutunaw?
Napansin ko din yun sinabi ni SC na magpapaalam sya kay Mamang at Teresita (parang may Aling naman ata) yun haha o sadyang bingi lang din ako? At si Emman kahit nakakainis yun ginawa nya pagbunyag sa proposal, pinapatawad ko na sya haha dahil mas kaabang abang ang magaganap na proposal dahil nalaman na ni Maya ..What if si SC ang ma surprise?
Kilig much ang stolen kiss at with matching I Love You ♡♡♡ plus the way he said this line: “alright, you’re upset…” “sabi ko na nga ba eh…di mo ako matitiis…”
Yes, the magic is back because of the much awaited proposal and their super duper level up sa sweetness and kisses. Kudos to the people behind the show! You never fail to keep us on our toes.
Piloy PgeMy 6th sense told me it will be at Lim’s garden, witnessed by the SC and Maya;s family. Scenario would be Dona E would invite everybody for Zumba dance class. Then they will witness chinese lantern going up the air ( Remember during the chinese lantern episode SC realized he is falling in love to Maya) While everybody dancing the Zumba. The LIm kids would have a banner that says ” WILL YOU MARRY OUR DADDY CHIEF” Then SC will kneel infront of Maya with the ring. Music will be theme song of BCWMH. Iy will be playful, funny, sweet and unpredictable.
Tweets from Jimuel:
@Jimuel: Yung feeling na yung magpo-propose, hindi alam na alam na ng pagpo-proposan niya ang tungkol sa proposal.
@Jimuel: BUT! Sure ba tayo na hindi alam ng magpo-propose na alam na ng pagpo-proposan niya ang tungkol sa proposal?#BeCarefulWithMyHeart
I think pag nalaman ni SC na alam na ng Dorbel, alam nya na pwedeng nakarating na kay Maya. Mas gusto ko na alam ni SC na alam ni Maya ng hindi nila pinag-uusapan, para mas makapagplano si SC ng mas kilig na proposal gimmick! Yung tipong pagurin nya si Maya kaka-anticipate tapos… at her least expected moment… kaboooom!
I’m watching today’s episode….
SC’s description about Maya:
She’s very simple… (she’d react if I give her something extravagant)
She’s caring…
She likes doing things for other people… (she even likes to cook for us, eventhough she’s a terrible cook)
She’s playful and funny…
Sweet…
She can be very stubborn at times…
She’s unpredictable…
And very sentimental…
She likes keeping things for remembrance… (kahit noong hindi pa kami)
… KILIG OVERLOAD talaga
G. IsaacsCan anybody just plea the fifth for once? Emman, anyone?
If I saw my boyfriend with another woman, my reaction would be to cry after the initial shock has passed. Yup, I think that’s normal to at least have a teardrop fall, not quite like Edz but along those lines. I must say Maya has nerves of steel now, the girl who used to be reactive, transparent and full of emotions has turned supernatural. No real emotions except anxiety, like her world does not revolve around SC anymore. Good for her. I doubt it doesn’t but I guess it’s true. I’m just confused how far removed her reaction is from her usual self. If it were anybody else their reaction would be exactly as I pictured it in my head. Like she did at the summit after SC accused her of flirting with her boss. Maya would have been shocked, distraught, confused, preoccupied with all the scenarios in her head, betrayed, angry, unloved, sad, very sad. And like before all she had the energy to do was to hug Emman and cry in pain. No deep effects,it’s either she was really clueless or in denial. But that’s over and one with. Now, however, I feel cheated. Is it that hard for people to keep a secret? Seriously? And should they be so casual about divulging such like talking about the weather? I’m not even concerned about the flow of the story anymore. Another deflated episode in my opinion.
I like the twist but not the acting. So unnatural except maybe for NT. I give her 2 thumbs up. Team NT ako tonight.
On the other hand, thank goodness for Ms. Abueg who is ever so stylish and poised as expected and always on point. There’s something good about every episode, I suppose.
I know my time will come when this show will just blow me away. I know it’s there somewhere. I’m still waiting.
Theresa VillaIt could be somewhere in the Lim’s place.. Veranda while having coffee? But maya doesn’t live there anymore..and she seldom stayed late at the mansion anymore plus the family will always be around them..the lawn? Could be pero Baka umulan.. Remember, wet season sa pinas ngayon.. The principal’s office? If u notice it the desk was always between them during conversations.. Not too romantic.. Richard always had the upper hand on that room.. He was always sitting while maya was on her feet..
My bet would still be Abby’s room.. The only place in the house where they both let their guards down.. Maybe, Richard will be in cahoots with Abby(just like their monthsary.) maybe he will have the ring tied in the slam book and with a written question on Maya’s unfinish? page “will u marry me??”..
Thanks for this!!! I really loved that SC said all these things about Maya, parang nilagay niya si Maya sa pedestal, love na love niya talaga!!!
Super hilarious ang “spa” & ang kape scenes. Pero wagas ang stolen kiss scene! Mapapa somersault at parkour ka talaga sa kilig at galak!
DENNIS VILLACORTEIt’s amazing how we all know this story’s destination, but the journey is no less enthralling and exciting and funny and Kilig-inducing. That’s what I’ve learned from today’s episode: enjoy life’s journey. It’s a blessed thing.
Mga laugh trip scenes na posibleng mangyari sa dinner date na yan:
-Aabangan ni Maya ang lahat ng ihahain ng waiter… baka may ring
-Iso-SOCO ni Maya ang mga utensils, food and drinks… baka may ring
-May mahuhulog at mapapaluhod si SC para pulutin… At iisipin ni Maya na baka maglabas na ng ring…Gugulong ako sa kakatawa pag ganito!
Natawa ko dito. Walang pagsidlan ang kilig ko sa eksena nina Maya at SC. Ang sexy lang ng papalanding na kiss ni SC. Lips Airways. I so love your liiiiiiiiippppppsssss RY!
Pinakamagandang angle din for me. If this is a very good angle, ilang takes ang naganap!!! OMG!!!!!


2319 days agoWinnie R OntiverosLinda and Hot Wasabi When I reviewed that part of the kiss, Maya actually kissed him back and she realized what she did so she wiped off the kiss from her lips and tried not to smile or laugh. So Richard said, I knew you can’t resist me. That is why when he left she was silent screaming to herself because nakalimot siya na galit siya kay Ricardo. Sobra kasi magpakilig e kaya na kiss tuloy niya si Ricardo ha ha…
Elsa DuboisI didn’t quite understand bait SC said that either. I think she “kind of” kissed him back. Dapat stressed yung kiss na yun specially her kissing him back. Slow motion.

Tita RYOU’VE MADE ME SO VERY HAPPY
=================================
to the bcwmh team, thank you cuz you’ve been making us, the ka-adiks
of this teleserye, so very happy for more than a year now. it has been our
virtual joyride that majority of us wish it would last for the longest time.
i thought this is another song that captures what SC feels towards maya.
i copied portions of the song that i think reflect SC’s feelings.
i hope those who would care to listen, enjoy the song as much as i do.
another blast from the past! happy listening!
=====================================================
I lost at love before
Got mad and closed the door
But you said “Try, just once more”
I chose you for the one
Now we’re having so much fun
You treated me so kind
I’m about to lose my mind
You made me so very happy
I’m so glad you came into my life…
you came and you took control
You touched my very soul
You always showed me that
Loving you is where it’s at
You made me so very happy
I’m so glad you came into my life…
I’m so in love with you
All I ever want to do is
Thank you babe, thank you babe…
I want to thank you, girl
Every day of my life
I want to thank you
You made me so very happy…
========================================
YOU’VE MADE ME SO VERY HAPPY – blood sweat & tears
http://youtu.be/quVpo96O3ZU
YOU’VE MADE ME SO VERY HAPPY – lou rawls
http://youtu.be/jYgtLmfgwCw
==========================================
sending everyone good positive vibes! tyvm bcwmh!

Yun kiss!!! may tunog!! Hindi pa diniretcho sa lips eh sa gilid pa!parang wala sa script? kung maka react si Maya
Ang confidence level ni Ser Chief ibang klase! kung sabagay ikaw ba naman titigan at ngitian ng ganyan tas labas dimples hindi ka ba matutunaw?
Kilig na kilig ako promise!!! Ang swabe lang ni SC sa pag sabing hindi sha matiis ni Maya. Nun paalis na sha kala ko iisa pa e kasi mejo nag lean forward pa sha.
Cute ng dating when Maya said “kasi naman e!” Tas ang attitude ni SC kanina eh ang lalaking confident na walang ginagawang masama. Hihi.

Kilig much ang stolen kiss at with matching I Love You ♡♡♡ plus the way he said this line: “alright, you’re upset…” “sabi ko na nga ba eh…di mo ako matitiis…”
Yes, the magic is back because of the much awaited proposal and their super duper level up sa sweetness and kisses
Kudos to the people behind the show! You never fail to keep us on our toes…
Tawa din ako nun nagkkwento ng proposal moment si DE. Parang may “ahi” na tunog kilig. I am loving her na talaga!
Lastly, si Mamang naman kung kiligin nun malaman na sha ang pinaguusapan ni SC at Maya.
Di na mawawala sa isip ko ang halik na yan ni SC kay Maya. Ever! Passionate kiss lang. Pero mas gusto ko ata yung barya baryang kiss para lagi pa rin akong may aabangan. Hay buhay FA. Malala na.
Winnie R OntiverosMaya and Ehman arrive home. Maya greeted Nanay T and Mamang. Nanay T asked her how her date with Richard went? She ignored the question. She is obviously not in the mood She tells them she got some fruits for them. She complained of having a headache and wanted to go to her room to rest. Nanay T could sense something was wrong so she immediately turned to Ehman to ask what happened? He didn’t answer.
At the Moons Brew and Pastries, Richard and Ms Abueg are finishing up. Richard apologizes for not walking her to her car. He said he needs to still buy some dessert. She asked if it is for Maya? Richard said yes. She then asked him if it is different this time? (Wow is it customary for a jeweler to ask customers personal questions like that? Maybe she feels like they are now bff’s because he is a friend of Raffy’s? Maybe? But I was just surprised at the question.) “About what?” Richard asked Ms Abueg. She said “About this wedding?” Richard answered truthfully. He said, “Yes. The first time around, you have no experience. You don’t know what to expect. You just plunge in but you know the feeling…the nervousness, the excitement, it is still there. It is probably because this is a different woman that I am about to marry and this will be a whole new experience. I guess the only difference is that I am more confident now that I can face everything that comes afterwards.” “She’s a lucky girl.” Ms Abueg replies. “I hope she sees it that way.” Richard said. “She will.” She said and then she shook his hand and left.
“A woman? Richard?” Nanay T asked Ehman. “Are you sure about that?” Mamang interjects and tells Ehman that maybe that woman is someone that Richard had to talk to regarding the wedding. Ehman’s eyes got big. “Wedding? What wedding?” he asked. Mamang then told Ehman about the planned proposal before Nanay Teresita could stop her. (Oh dear…another cat out of the bag.) After Ehman learns about all this, it seemed that a light bulb turned on. (Oh my pink gosh Ehman says ha ha I love when he does that.) Ehman was sure he has seen that woman before. He rushes to his magazine rack and opens the pages of one of his bridal magazines. He sees the picture and then points it out to Mamang and Nanay Teresita. They now understand what this meeting is all about. At this time, the intercom rings. The lady guard informs them that Richard is downstairs. They all got frantic and Ehman tells the lady guard to let him in. Maya comes out of the room. She heard the intercom and she asks who it was? Ehman tells her it is Richard (yikkes…Maya calm down…ha ha) She is in attack mode right now. She wants to know what is going on. She heads for the door while the three try to stop her. “Don’t over react” Nanay T said. “Calm down” Mamang and Ehman tell her. They urge her to have a conversation with Richard inside the condo. But Maya just won’t hear it. When she opens the door, Richard was already there. Carrying a box of cake. They let him in and the three made an excuse to leave them alone to talk.
Kung napakanta at napajoin ni Maya si SC sa mga games nung birthday niya (which if we think about it, was contrary to SC’s personality), anything is possible at this point!!! Pordalab na lang! All in the name of His Love for Mayabels yata ang peg ni SC!!! So am expecting something also out of the ordinary na gawin ni SC for the proposal!!!

Pag selos mode si Maya…..hindi masarap ang kape!
Bitter ba ang taste SerChief? Halata na ba talaga na she’s upset?
JR RThat Maya found out about the proposal is impressive writing by the creative team. It actually deviates from the cliché “surprise proposal” on the girl. This is actually more brutal (in a funny context) for the bride-to-be not knowing the when and how of the plan. This will keep Maya to walk in eggshells every time she’s with SerChief. ..hahahaha. This gives new meaning to JSM’s song “Torete”.
Everyone and their brother will know about this proposal and will set off a feeding frenzy from the mansion to San Nicolas. All will be putting in their two-cents but I hope when proposal day comes it will come down to just the two – SerChief and Maya.
My preference is not the tabing ilog romantic place since this has been the scene for Maya’s I-Love-You, too. I’d prefer the Jones Bridge where they actually first met face-to-face. No bells and whistles required, just a simple long streamer across the span of the bridge facing the water that says” Will you marry me Maya?”. SerChief will just need to figure out a story to take her back to the bridge.
Guessing aside, watch DR’s and DE’s lines about “proposal just for 2 people” and the fortune cookie mishap. My gut feel tells me the scene is between SerChief and Maya only and it will happen in a very unexpected way dahil “iba sila”. My insides are somersaulting at the thought of this impending scene.
Ang ganda! All the elements are here… kilig… katatawanan… as in!!! Ito ang mga dahilan kung bakit unang napamahal sa atin ang show.
Hindi ko na dadagdagan ang enumeration sa kilig scenes. Nabanggit nyo nang lahat! Share ko na lang yung mga dahilan nang pagtawa ko sa epi today:
-Pumi-PBB Teens si DE! Ang lAndi nya pala pag kilig moments nila ni DR ang topic!
-So, tinawag si Emman ni Ateng Receptionist ng Mr. Castro? Parang hindi bagay ang pangalang yan sa isang may ari ng condo with pink walls!
-Ser Chief, kung ayaw mong laging mapait ang lasa ng kapeng iinumin mo, umayos ka!
I’m actually excited to see Maya wearing her “Lim’ FA pin!
Baka plano nga ni SC to tell everyone else dahil alam nyang makakarating din Kay Maya. Hay… lets wait na lang kaya sa pasabog na proposal! Excited.
Evangeline TasipitHa ha haha….I luv u BCWMH,…..everybody ‘s soooo excited….including Maya!……and ME……How will be the proposal kaya?….of course it will be soooo romantic but how, when and where?……….hayyyyyyyy…..so exciting……I can’t wait……..
So, ilatag ang red carpet sa pagbabalik ng Assumera Queen, the future Mrs. Maya dela Rosa-Lim.
This is what I love about this show! Aside from the excitement build-up with the upcoming proposal, pinupuno rin nila tayo ng hilarious scenes!!! And of course, kilig scenes na palevel-up ng palevel-up are very much present sa mga episodes recently.
Still have to watch the epi but I have read your updates. So happy na wish come true ang next epi sa mga adiks… Welcome back, Ms. Assumera, Maya Dela Rosa!!! Mahohopia ka lang! Hilarious and kilig episodes are upcoming.

Waaaaaaaaahhh..wagas naman pala ako makatawa dito……
Hi Ayra Ikaw na ang pinagpala na makasama sa eksena nila. How was the experience?
Linda BernardoI so love the matriarchs for their gesture to be in their best behavior and put their differences aside for the sake of their loved ones, SC and Maya. I am glad hindi na mag-gigirian ang.dalawa. Pwede na nilang putulin ang mga claw nila.
When SC told Ms. Abueg Maya’s personality, he enumerated them with so much love and pride. One thing he missed though, Maya always thinks about other’s welfare before her own. “She is one lucky girl” said Ms. Abueg. I beg to disagree. SC is the lucky one. Not everyone is given a second chance to find love such as Maya’s. I concur with Nikki, they are lucky because their dad falls in love again to the right person…so heartwarming. Love you Nikki!!!
What a sweet revenge when Maya served SC him coffee although he does not deserve it. SC tried to steal a kiss from Maya and todo iwas niya. Hindi ko get when SC said “sinabi ko na nga ba, hindi mo ako matitiis”.
Hindi ko masisisi si Mamang for teliing the secret kasi for sure mas lalala ang tampo ni Maya. Si Eman naman true to his character panira nang excitement.
Maya Is invited to dinner the next day. Team Maya thinks this is the day SC will propose. I don’t think so. The engagement ring is custom-made, it will not be ready agad agad. Also Raffi suggested to SC not to make the proposal sa restaurant.
Kita kitz tayo tomorrow. Excited na ako.

Hehehehe..mega prisinta po talaga ako…ang tamlay po ni mayabelles..mukhang may sakit sya…..payat nga si RY sa personal..
Bonus pa na naging extra ka dun Kwento ka naman kahit konti.
Hot WasabiHello Linda,
You managed to thoroughly cover all the important points in your review, Sis. Quite insightful.
On SC’s reaction when he tried to steal a kiss from Maya? It is the first time that Maya broke into a smile since he walked in, thus the comment.
I also think that the restaurant is not the venue for his proposal. I believe the creative team has something hatched for all of us. Richard will propose when Maya and all the viewers will least expect it. Let us just enjoy the ride. Weeeeeeee!
Pasensya detelyado to ah…
5:15 am nasa airport na po kame..tapos pagdating dun sabi ng tiger airways cancel ang flight namin at ililipat nalang daw po kame pag may available pa na seat sa cebu pac..pero 8:20am pa ang flight ng cebu pac pabalik ng manila..so sobrang delay at nakakainis un ganung eksena.,after ng ilan oras ayun nakasakay din kame pabalik ng manila..mga 9:30am kame dumating sa NAIA tapos pagbaba namin sa terminal 3 marami na tao tapos may mga light..then nag ask kame kay manong guard if anong meron..then sabi nya shooting,,kaya ayun napasigaw na ako at sabi ko be careful yun.kaya ayun mega takbo kame..tamang tama naghahanap si kuya ng volunteer ba ekstra at ayun na po ang nangyari..NAGPRISINTA PO AKO..hehehe..kwentuhan lang daw kame ng kasama ko at wag masyado pahalata na tinitingnan namin sila…ang gwapa at gwapo nila parehas.3 beses *** shoot..bawat shoot nililipat kame ng ibang area so hindi ko po sure if makikita kame ng ka officemate ko………
Wala ka bang pwede ma i-share na spoiler alert jan sis?
Hehehe…medyo busy lang po ng mga nakaraang araw..wala masyado eh,,after kasi ng scene na yun..pumunta na sila sa dressing room para magpalit ng damit at next shoot daw ay sa resto..
Pero ito un line narinig ko sa convo nila
“SC:Maya umiyak kaba?
Maya:Hindi SC may iniisip lang ako.”
Yan something ganyan po medyo malayo kasi sila sa convo eh..nasa labas na sila nun..
Thank you Tiger Airways kasi cancelled ang flight mo…
Ang ganda naman ng experience mo sis! Isang FA (forever adik) ka na talaga!
Hot WasabiWHERE, WHEN AND HOW
There! Now the secret is in the open. Everyone knows the secret, even Maya does. The only one who does not know that everyone is knowledgeable of his secret is Richard himself. What a twist!
We know that Richard is going to propose to Maya. That covers the What and Who. That leaves us with the Where, When and How is Richard going to propose to Maya. Everyone weighs in. Here are some of their thoughts on this subject. The Hows and Wheres:
1. Nanay Teresita’s version is what Maya considers to be the most romantic proposal. She even brought Richard to the location where her parents got engaged. But the only problem with this is that Tatay Arturo abandoned his family and to this day he is still a persona non grata to her mother-in-law. I am sure that there is an explanation for his sudden and unexplained disappearance. But to follow his footsteps does not bode well for a “happy ever after” love story for Richard and Maya. SIDE NOTE: My opinion on Tatay’s disappearance? He did it for a noble or heroic reason. He found out that he has a debilitating disease. He does not want to be a burden to the family. To spare them of the hardship that his medical condition will impose upon his young family, he decides to disappear. I believe that Nanay T knows how to choose who to love. She loved the right man and the right man chose the best decision he made, in his opinion, para sa ikabubuti ng lahat. I am still waiting for the Creative Team to tie this loose end: why did Tatay leave? Maybe in Book II that will be answered.
2. Mamang offers her surprise proposal done using an airplane, where one would fly around pulling behind the sign “Will you marry me?” Or Richard arranging for his proposal to be done in the air, in the flight that Maya will be assigned to. Wouldn’t it be cool to have Captain James Ventura be the pilot for the flight again? And the flight heads to San Nicolas again!
3. Dona Esmeralda shared how Don Roberto proposed to her at a Chinese restaurant using the fortune cookie. The funny thing is that she ended up with the fortune cookie that had the question “will you marry me?” ha ha
4. However, Raffi recommends that Richard not do it in a restaurant setting because according to her, it is so yesterday.
5. Nikki suggests that it should be done in a public venue where multiple cameras can capture the moment. What else can we expect from Nikki, she is after all a budding thespian.
6. I suggest that the creative writers take an inspiration from the flashmob proposal of Jamin, done in Downtown Disney, as he and friends dance to the tune of “Marry Me”. Yes you can google it if you want to see it for yourself. The production team can use the talent in dancing and music of the bagets in the West Teatro drama club and the Music and Sound club, combined. That way they can demonstrate their talents for all to enjoy. Thus far we only see them meeting. Time for them to show off their talents too.
I am sure that Richard will come up with his own romantic version of his proposal. Maybe he will go back to the grounds of PUS and propose to Maya under the stars there. Or he may take her on that dinner cruise, the aborted plan for their first date. Only, Richard will charter the whole ship so that it will only be the two of them on board.
When will he do it? Now that is the creative writers’ secret. That will be their surprise for all of us! Hahaha.

Linda BernardoI am guessing, SC will choose the dinner cruise. Maya had regret to miss boat then. Who knows, SC is also unpredictable. His romantic gesture nakakahina ng tuhod.
Yvette TanAll your guesses are really exciting!!! mapupunit din yata labi ko…my hubby keeps asking what’s wrong with me…can’t seem to take the smile off my face 🙂
My guess is the proposal will be both super funny and super kilig maski saan pa man gawin yan….sa dami na nilang nakaka alam ngayon halo-halo na din mga ideas nila (kasama na din tayo nakiki plano sa much awaited proposal aaaayiiiieeee!) then ofcourse I just remember SC’s line when they had their first date…”nothing goes to plan pagdating sa ating dalawa” so feeling ko we are in for a big surprise once again….when, where and how? Bahala na si Batman! Basta’t ako maski patagalin pa ng mga dear writers natin ayos lang ako….nakakatuwa kaya panoorin si Maya with her old aligaga self and super cute si SC sa mga da moves niya 🙂
Just finished today’s episode!
Super hilarious ang “spa” & ang kape scenes. Pero wagas ang stolen kiss scene! Mapapa somersault at parkour ka talaga sa kilig at galak!
https://www.youtube.com/watch?v=OCRd4fAW3Hc
https://www.youtube.com/watch?v=OCRd4fAW3Hc
Wednesday, August 28 s
Mga laugh trip scenes na posibleng mangyari sa dinner date na yan:
-Aabangan ni Maya ang lahat ng ihahain ng waiter… baka may ring
-Iso-SOCO ni Maya ang mga utensils, food and drinks… baka may ring
-May mahuhulog at mapapaluhod si SC para pulutin… At iisipin ni Maya na baka maglabas na ng ring…
Gugulong ako sa kakatawa pag ganito!
Cynch HonradoDona Esmeralda narrated how Don Roberto proposed in a very nice restaurant even if there was a mishap with the fortune cookie. But Dona Esmeralda is right the Richard is conservative so Nikki’s idea will not work. And per Rafi, nothing common too….so I am guessing it might be in the most romantic place where Richard and Maya confirmed with each other “tayo na; as in you and me.”
Kute telling both Nanay Teresita and Mamang na dapat sa San Nicolas sila Richard mamanhikan……….ay ang bilis, mag-propopose pa lang eh…si Maya muna.
Mamang’s idea of a banner in the plane’s tail stating “will you marry” and or inside the plane where Richard will propose in front of the passengers
Mega tawa ako sa mga possible antics ni Maya while hinahanap ang ring!
Tom Rodriguez wants ‘Be Careful’ role back
ABS-CBNnews.com
Posted at 08/27/2013 6:56 PM | Updated as of 08/27/2013 6:56 PM
Winnie R OntiverosRichard apologizes to Maya for breaking their dinner date. He hands her the cake. She says thank you but Maya’s mind was saying something else. She looked at Richard sternly. Her mind thinks, “Maya are you going to fold right away? He gives you cake and you can’t say anything anymore?” Richard senses something odd. He asks if there is anything wrong? Maya said, “Nothing” but in her mind she wants to say “yes, I saw you with another woman earlier.” Instead Maya asked if he wanted coffee. Richard said yes and he sat back down at the table. Maya got a coffee cup and made Richard coffee making some casual conversation and asking him how his meeting went? It’s ok he said. She asked if Atty. Ryan and him finished all the contracts? Richard said yes. In Maya’s mind she is thinking that Richard is stubborn and continues to stand by his lies. She mixes the coffee and gave it to Richard. Richard took a sip of the coffee and just about spewed it out. Maya is obviously not very happy because she made a very brave coffee. (matapang na kape) Richard could feel she is still upset but he thought she is upset because he broke the dinner date. He gets up and faces Maya who is still looking stern. He said, “ok you are upset.” In Maya’s mind she wishes Richard would just tell her the truth. But instead Richard said he is going to make it up to her. She is still not happy. So Richard said she is “suplada” (snobbish or unfriendly). Maya almost slipped but stopped herself. Richard promised this would be the last time he would ever cancel dinner. (ummmm excuse me Richard. You may not be able to keep that promise because one day you will find another reason why you can’t make dinner. I’d take that back if I were you ha ha. But in fairness, Maya has never ever cancelled on you. She would make an excuse not to accept your invitation but she never cancels on you. Just saying.) Maya nods with a slight smile on her face. He tells her he loves her. Then he asked how Mamang is doing? Maya gives him an answer and Richard made her promise to give him an update as to the result of Mamang’s tests. Meanwhile, inside the room, Ehman’s ears were stuck at the door listening. Mamang and Nanay T waits for an update form him. Mamang asks what they are talking about. Ehman says it’s about her. Mamang reacted to that feeling special ha ha. Ehman said their conversation seems normal but he is still afraid that Maya would just suddenly blow up. (what???? Like a balloon? Ha ha…She can’t resist Richard’s charm ha ha Watch…just watch!) Richard said that Maya looked tired so he wants to say goodbye to everyone. Maya said she would let them know. He then surprised her with a kiss but Maya could not resist and she kissed him back (Waaaaaaa! I am so doing a Dorbel silent scream right now because my Ser Cheap is still sleeping ha ha) Maya momentarily forgot she is upset with him. She wipes the kiss off her mouth to cover up (bwahaha silly girl) Richard had this grin on his face. He knew Maya could not resist him. He said goodbye and turned around and left. Maya blushed and did a Dorbel silent scream while she checked to make sure Richard wasn’t looking. Ha ha She was so cute. (That was my most favorite part of the episode. I burned the rewind button on that one. )
At the mansion, Nikki and Luke talk about their Dad’s plan to remarry. Luke said he could fully understand his father. He didn’t want to grow old alone. Nikky tells him he won’t be alone because they are there. Luke explained that yes they are there but that eventually they will have a family of their own and may move away. It is better that someone is there for their father to go through life with. Nikki then recognized that fact that they are lucky that their father found the right person to love for their sake. Luke agreed. Then she said that she didn’t think she would be able to accept someone else to replace their mother. Luke said that their Ate Maya isn’t going to replace their mom. No one could replace their mom in their hearts but they could love Ate Maya just the same. (Awww I love this conversation. Luke is the voice of reason. He is really maturing right before our very eyes and I am so proud of him. He always had a soft spot in his heart for his Ate Maya.)
Winnie R OntiverosBack at the condo, Maya tells Mamang, Nanay T and Ehman that Richard didn’t tell her the truth. He continued his charade about meeting Atty. Ryan. The three had to tell her to calm down because they do not believe Richard is cheating on her. Maya didn’t even realize that even Ehman agrees with them. Mamang tells Maya that she is over acting and starts to laugh. Maya asked her why they are laughing at her? She thinks the reason why women are cheated is because they are very trusting and just let things go. She heads back to the room and said she will call Richard to get to the bottom of it. The three started to get frantic again to stop her. Ehman could no longer contain himself. He took the magazine and turned to the ad page. He points out the picture of Ms Abueg, tells Maya she is the best engagement ring maker in town and that Richard is about to propose to her….(Yikkkkes! Silent Scream alert) Maya looks at the picture and was dumbfounded. Nanay T covers her mouth because she didn’t get to stop Ehman.
Next time on BCWMH
Manang Fe tells Richard that she learned of his plans to propose to Maya. She tells him how happy she is for him. Richard hugs and kisses his yaya and tells her that this is it. (This scene really warms my heart. They soooo love each other.) Maya talks to Nanay Teresita about her feelings about Richard’s plan to propose. She said she is so blissfully happy but worries that she isn’t ready yet. (I am so happy Nanay T is there in person to talk to Maya about it because she needs her to keep her head straight.) Richard calls up Maya. He asked how she is. She said she is doing great. Obviously in high spirits, Richard asked her if she wants to go to dinner? Maya silent screams her excitement. Ehman reacts to it and said she needs to look at the food for Richard might place the engagement ring there. Mamang said maybe he would drop it in a glass or something. Nanay T tells her just beware for without warning he might just drop to one knee in front of her. Maya is overwhelmed by all these ideas and the proposal. (Weeeeeee! I can’t wait. I might need a brave coffee tonight so I could stay up to watch tomorrow’s epi without falling asleep.)
MANILA — “In a heartbeat!”
That was actor Tom Rodriguez’s quick reply when asked if he would be open to reprise his role in the hit daytime series “Be Careful With My Heart.”
The 25-year-old actor, who portrayed doting dad Jeff in the ABS-CBN “kilig-serye,” said he misses his co-stars in the daytime program.
“Miss na miss ko sila, ‘yung grupo, sina Aiza (Seguerra), sila Tita Sylvia (Sanchez), si Tita Divina (Valencia), si JM (Ibanez) ‘yung bata, lahat nakaka-miss. Kaya we try to keep in touch naman,” he told ABS-CBN News on Tuesday.

“Kaya lang ngayon dahil sa schedule, medyo araw-araw may work, minsan hindi maiwasan na we lose communication for a few weeks, pero we try naman,” Rodriguez said.
Cynch Honrado“Sabi ko na nga ba hindi mo ako matitiis” Richard sweetly said after he stole a kiss from Maya. The man is soooooo in love – imagine the spontaneous narrative of who Maya is as Richard sees her and how he loves her so. Ms. Abueg knows it and tells Richard that Maya is very lucky.
Emman is a true friend he had to make the choice of making sure that Maya did not harbor the wrong reasons for Richard not being up front with her about his fabricated meeting with Atty. Ryan. Since the woman was someone that triggered recognition from Emman, he got the connection when Mamang insisted that Richard does not have any other woman, he might just have met with someone who will handle the wedding, so Mamang spilled the beans to Emman that Richard was going to propose to Maya, which then triggered where and why he knows the woman who was with Richard – from a magazine ad showing Consuelo Abueg as the best engagement ring maker in town.
True to form, the writers have twisted the surprise, it is not Maya but Richard who will be surprised as now Maya knows. Mamang ang even Nanay Teresita plus Emman were guessing how Richard was going to propose.
The brother and sister conversation upstairs is so heartwarming. It is a manifestation of how Maya has touched each of them. Luke being the sensitive to the need of Richard having a “katuwang sa buhay” and being sensible by telliing Nikki that Maya will not be replacing their mother, but they can love her just the same. Nikki on the other hand has come to realize that she thought she would not be able to accept anyone, and she feels they (the children) are lucky and just grateful to her Dad that he fell in love with the right people (first their Mom, then now Maya). Abby not in the scene is a given as she has always wanted Maya to be her mother. Knowing Alexandra as her real mother who is already gone, Maya is the mother that she got to know and loved.
On Nikki’s explanation of why she does not want to be involved with Nicolo’s mtv, thank you Nikki, you are finally realizing how to work things out and talk to your inner self on what is the right thing to do……you are finally growing up and taking full responsibility for all your actions.
On the teasers, Manang Fe had to have her moment, sweet of Richard to kiss Manang Fe…….Maya is now sweet to Richard, she’s okay now, anticipating the proposal, but wait, the ring is not yet available, there will be another meeting with Ms. Abueg after her Europe trip…hay naku Maya go with the flow and just have faith in Richard being true to you.
Another long wait for the next episode……..
The former Kapamilya star was last seen as Jeff in “Be Careful With My Heart” in June, before he went on to star in the ongoing GMA-7 series “My Husband’s Lover.”
As Jeff, Rodriguez portrayed the father of Cho (Ibanez), whom he fondly calls “Junior Pards.” The boy is Jeff’s only son with Kute (Seguerra), his lesbian best friend who he “accidentally” slept with after a round of drinks in their younger years.
Rodriguez’s last scene as Jeff saw him saying goodbye to Kute and the rest of her family, as he prepared to leave for Dubai to become an overseas worker.
Asked Tuesday if he is open to being “reunited” with Seguerra in “Be Careful With My Heart,” Rodriguez said, “If I’m given a chance to get to work with them, in a heartbeat I would take it.”
He also expressed willingness to appear in the upcoming film version of “Be Careful With My Heart,” which will compete in the Metro Manila Film Festival in December.
“Sana. Ako, I haven’t heard anything yet, pero if ever naman… I love that team, that group kaya, in a heartbeat,” he said, when asked if he would want to join the big screen project.
2319 days agoSweety PieGrabe….great great epis… I can feel the ride of our creative writers….nakakakilig the way SC is describing Maya..love na love niya talaga at ang
kisssss haayy sobrang heaven…like na like ko ang convo ni Luke and Nikki…so..so.. funny si Emmy nung susugurin nya si Ms Abueg…lol
Thank you very much BCWMH team another Bravo episode!!!! Can’t wait till the “WILL YOU MARRY ME?” part..haaay…inhale..exhale..
For now, Rodriguez is gearing up for the romantic-comedy “Let’s Take a Chance,” where he will co-star with Carla Abellana, JC de Vera and Nina Jose, among others. The movie, produced by Regal Films, is under the direction of Jun Lana.
(http://www.abs-cbnnews.com/entertain…eful-role-back)
Sana, Tom would also be part of the BCWMH movie, kahit guesting lang kasi, kulang ang magic ng mga taga San Nicolas pag wala siya eh!!!
Linda BernardoHW, agree ako about Manang Fe. I remember when Mang Fe was sick, she was talking to SC about the right woman for him. In her mind she was describing about Maya then. SC responded, that kind of woman does not exist anymore. And at this point Maya came in and said ” ako na yan”
Inuna ko muna talagang mag BR para maGV ako. Mukhang maganda ang epi a. Feeling ko eto ang pinakagusto kong kiss ni SC kay Maya. As in iba ang dating eh. Slightly open and may pwersa ang leps ni Mamang Singkit. Capture na capture ng GIF ni Sis Mishie! Super thanks sis *** na talaga.
http://i.imgur.com/BN4Qwjs.gifhttp:/…om/xg1ZMPb.gif
http://i.imgur.com/mimzINr.gifhttp:/…om/8liNMFE.gif
http://i.imgur.com/V3eWgzf.gif
Malapit na ako magbalik loob haha 2 more weeks! …sagabal lang talaga ang real world
Salamat dito mishie Huling-huli ang pagnguso ni Maya
Hot WasabiHello Cynch,
The scene between Manang Fe and her Ricardo is so poignant and it is the most tender moment in the whole episode. Manang Fe saw from the very beginning the possibility of Maya becoming her charge’s better half. She wished and prayed for such a moment as this to happen. She must be so ecstatic to see that her beloved “son” is so happy.
Thanks for sharing your great insights, MINK. *.*
Bakit ganon reaction ni Maya nung kiniss sya ni SC? Parang sinuck in pa nya yung kiss, as in ninamnam yung laway???? Waaaaaahhhhhh!!!! kilig gravehh!!! ang yummy!!!!! SPG na ba????
At tinakpan pa ni Maya mouth nya… dinilaan kaya nya yung laway ni SC?? Wwaaaaaaahhhhhhhhhh!!!! Enebeyen!!!!! BCWMH… anong ginagawa mo saming mga adik!!!!!
Zel MJo E sis, I will have to agree with you on Maya knowing the secret as it might just averted a much worse scenario should she wasn’t privy of why SC kept her out of the loop and even lied to her. I guess, the lesser catastrophe of knowing will be much palatable than a potential breakdown of understanding between the two.
I also agree with you on your take on RY’s acting ability. He had improved a lot in the pastyear, comparing it back to the start of the series, he is far better in his facial expressions, in the delivery of lines and he is much relaxed and spontaneous, the character becomes him, making it more believable.
Natawa ko dito. Walang pagsidlan ang kilig ko sa eksena nina Maya at SC. Ang sexy lang ng papalanding na kiss ni SC. Lips Airways. I so love your liiiiiiiiippppppsssss RY!
Pinakamagandang angle din for me. If this is a very good angle, ilang takes ang naganap!!! OMG!!!!!
Kilig na kilig ako promise!!! Ang swabe lang ni SC sa pag sabing hindi sha matiis ni Maya. Nun paalis na sha kala ko iisa pa e kasi mejo nag lean forward pa sha.
Cute ng dating when Maya said “kasi naman e!” Tas ang attitude ni SC kanina eh ang lalaking confident na walang ginagawang masama. Hihi.
Tawa din ako nun nagkkwento ng proposal moment si DE. Parang may “ahi” na tunog kilig. I am loving her na talaga!
Lastly, si Mamang naman kung kiligin nun malaman na sha ang pinaguusapan ni SC at Maya.
Di na mawawala sa isip ko ang halik na yan ni SC kay Maya. Ever! Passionate kiss lang. Pero mas gusto ko ata yung barya baryang kiss para lagi pa rin akong may aabangan
Hay buhay FA. Malala na.
Zel MJo E sis, I will have to agree with you on Maya knowing the secret as it might just averted a much worse scenario should she wasn’t privy of why SC kept her out of the loop and even lied to her. I guess, the lesser catastrophe of knowing will be much palatable than a potential breakdown of understanding between the two.
I also agree with you on your take on RY’s acting ability. He had improved a lot in the pastyear, comparing it back to the start of the series, he is far better in his facial expressions, in the delivery of lines and he is much relaxed and spontaneous, the character becomes him, making it more believable.
Kahit kelan talaga very unpredictable ang events. Parang ni isa sa mga suggestions dito for the proposal walang tumpak
Kung napakanta at napajoin ni Maya si SC sa mga games nung birthday niya (which if we think about it, was contrary to SC’s personality), anything is possible at this point!!! Pordalab na lang! All in the name of His Love for Mayabels yata ang peg ni SC!!! So am expecting something also out of the ordinary na gawin ni SC for the proposal!!!
Jo ELove this episode. I still think that Maya is better off knowing about the forthcoming proposal. She told Nanay T that she doesn’t think she’s ready. Now that she knows, she can get emotionally ready before Ser Chief pops the question. She also gets spared of the unnecessary suspicion and hurt if she didn’t know that Ser Chief was meeting the jeweler. So Emmy is actually an angel for telling her about the proposal.
It will be an exciting dinner, with Maya on the look out for the engagement ring. We know that Ser Chief is not proposing in the restaurant, besides he doesn’t have the ring yet, the restaurant will be too ordinary venue for his proposal. By the time Ser Chief proposes, Maya will be so ready that she will be anticipating for the event.
Richard Yap has become a very good actor. When he was telling Ms. Abueg why it’s different for him this second time he’s marrying, he can express his emotions, and he looked so handsome and happy.
Great job BCWMH team. You are all great and know how to keep our interest and love for this show. Some teleserye’s I want them to end, but BCWMH I never want to end.
Maria TanAs always BCWMH you have done it again!!! I love the conversation with Luke & Nikki it ‘s so heartwarming, you can feel the excitement of everyone around them, and the way SC describe Maya’s personality with the jeweler, you can feel the love coming from his heart, and now that everyone knows about the Proposal, what’s next for Maya & SC,.. Creative team You never fail to make us look forward to the next episode… Love it…..
Gusto ko ulit ulitin ang bye ni SC
hihihihi
On the loop
Abangers si Maya teh kala may kasunod pa.
Just watched the epi (Haha, late na!)
Ang ganda! All the elements are here… kilig… katatawanan… as in!!! Ito ang mga dahilan kung bakit unang napamahal sa atin ang show.
Marinela NolascoBCWMH team , you,re the best! I hope SC and Maya and the whole team never get tired doing this teleserye…laughter, Gigil (on maya,s and eman!s reaction)
Hindi ko na dadagdagan ang enumeration sa kilig scenes. Nabanggit nyo nang lahat! Share ko na lang yung mga dahilan nang pagtawa ko sa epi today:
-Pumi-PBB Teens si DE! Ang l*ndi nya pala pag kilig moments nila ni DR ang topic!
Maria TanAs always BCWMH you have done it again!!! I love the conversation with Luke & Nikki it ‘s so heartwarming, you can feel the excitement of everyone around them, and the way SC describe Maya’s personality with the jeweler, you can feel the love coming from his heart, and now that everyone knows about the Proposal, what’s next for Maya & SC,.. Creative team You never fail to make us look forward to the next episode… Love it…..

-So, tinawag si Emman ni Ateng Receptionist ng Mr. Castro? Parang hindi bagay ang pangalang yan sa isang may ari ng condo with pink walls!
-Ser Chief, kung ayaw mong laging mapait ang lasa ng kapeng iinumin mo, umayos ka!
Kay Amorhahahahah…sooooooooo love it!!!! super funny…tawa ako ng tawa….it is full of mixed emotions…yes there were lots of things/words to ponder on,in their conversations but what i like the most is NIKKI AND LUKE’S CONVERSATION;
Luke said:
Hindi pinapalitan ni ate maya si mommy..but we will love her just the same.
Nikkii:
W e are so lucky, dad falls for the right person..
awww sooo sweet!.
ooops special message to miss winnie O:
sorry for metnioning about the teaser yesterday.. i just happened to saw it sa Facebook…okees..promise..no more teasers…:)
#TeenagerLangAngPegniDE#
#EmmanAKAMrCastro#
#LeksyonKaySerChief#
Asin yata yung nilagay ni Maya sa kape kaya muntik maduwal si SC.
Lapit na proposal; susunod na ang kasal . Lapit ng maging Mrrs. Lim si Maya
#KahitIsangGabiLang
#KahitMinsanLang
#MayaPahiramNgAsawaMo
#UmeAngelLocsinLangPo
#OneMoreTry
MARIKYN GALICINAONever a dull moment in BCWMH!!!!! Abala silang lahat, nagpla plano ng proposal. By the time na mag propose si SC, I’m sure na plano na rin ang wedding. Sweet ang panakaw na kiss ni SC. Hhaaayyyyyy!!!! Their chemistry is soooooo AWESOME!!!!!
I’m actually excited to see Maya wearing her “Lim’ FA pin!
Magandang Umaga sa lahat! Ano na naman kayang klase ng kilig ang naghihintay sa atin mamaya.
Baka naman di magpapa-obvious si Maya sa dinner nila ni SC.Meron lang siguro kakaiba sa kilos nya na mapapansin ni SC.Feelinb ko malalaman ni SC na alam na ni Maya so kakaiba ang proposal na gagawin nya. Hirap naman manghula but nakaka excite!
Zaida SchmichNakakaiyak….matatapos na ang BCWMH!! Malamang next month eh kasalan na….eh birthday ko pa mandin tapos wala ng SC at Maya, huhuhu!!! PERO dapat super romantic ang proposal ha? SIGUE NA NGA….wait na lang ako for BOOK 2! Sana naman I will have the chance to see them both when I visit Manila in April. CALLING MGA KABISIG SANA TAYO DIN MAGMEET AND GREET!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
Aligaga mode na naman ang mahal na prinsesa… lahat ng ikikilos ng mahal na hari akala nya proposal na. at ang feeling na nahohopia siya…
Korek!!!
So, ilatag ang red carpet sa pagbabalik ng Assumera Queen, the future Mrs. Maya dela Rosa-Lim
Lucy Anne O’CarrollOH my PINK Gosh Emman, alam na ni Maya ang PROPOSAL so exciting to, kasi expect-expect c Maya every time my date cla ni SC….parang ring hunter ang peg ni Princess Maya nito….kilig much naman tong lovebirds natin…ikaw SC ha, alam mo na paano amuin ung GF mo, KISS lang ang katapat….
This is what I love about this show! Aside from the excitement build-up with the upcoming proposal, pinupuno rin nila tayo ng hilarious scenes!!! And of course, kilig scenes na palevel-up ng palevel-up are very much present sa mga episodes recently.
Kaya nga, ang hirap isipin na darating ang time na matatapos din ang show… I will miss them dito sa house (SC mode)
#SentiMode

————————————————————————-
FLASHBACK<<<<<<< REWIND
VOLUME 25
294 Date Aired: August 28, 2013- Kinakabahan si Maya sa magaganap na proposal ni Ser Chief. Will she give her sweet “yes” to Richard?
‘Ano Maya, tiklop agad? Binigyan ka lang ng cake?’

Tulaley ang Maya sa sinabi ni Emman, nganga, parang zombie pumasok sa kwarto.
Awwwww SC and Manang Fe.
Zel MToday’s episode is so heartwarming, touching and emotional as it is hilarious, funny and “feel good” from beginning to end. So many poignant scenes that tugs the heart and yet giving that roaring thunder of laughter as well. So what better way than to highlight those heartfelt scenes from the mother-daughter and mother-son conversations and give homage to the unconditional love a mother has for her child.
The relationship between a mother and her child is unparalleled and incomparable to any other relation known to mankind. A child bonds with his/her mother even before birth and all the more from the very first time he/she lays eyes on her… is touched by her… and cradled by her. The bond strengthens and intensifies as both mother and child spend boundless time together. The bond that a child develops with his/her mother can never be severed or disconnected. When a child is born the cord may be severed… but never in a mother’s heart for that bond lasts forever. And as the child grows up to become his/her own person, the child may come to forget or set aside the woman who nurtured and loved him/her but truth be told, a mother will never forget and will never stop loving her child.
So my take on today’s episode will be highlighted thru this nice poem as an inspiration.
A MOTHER’S WISH
How can I love my daughter and my son a little bit more?
How can I make my daughter and my son
to smile a little bit more?
How can I hold my daughter and my son in my arms
and they feel all of my love?
How can I make them more courageous
and not to fear their tomorrows’?
A mother’s love is selfless, giving and can never be replaced by anything else in this world. Nanay T, witnessing her daughter’s reaction of the biggest secret made known to her, could only hope the best for Maya. Nanay T, upon Maya’s recovery from the complete shock of knowing the impending proposal of SC, extended her listening ears and unwavering understanding of the events that had been unfolded to Maya. She kept nurturing Maya’s spirit, strengthening her soul by sharing her own experience so the anxiety will tone down, fears be lessened and giving her utmost guidance and undying love, reassuring her beloved daughter that no matter what, no matter her decision, the family will always be there for her, behind her in all her decisions.
In the same manner, DE was overflowing with happiness and had been grateful that once again her beloved son found that second chance at love and she was overjoyed of the fact that her Ricky fell in love again and will soon be getting that second chance not only at love but at marriage as well. For what mother would not want her son to be happy with the woman he loves.
This is my quest throughout the day
while I work, cook, clean, shop, and think:
A mother without doubt would always worry for her child any given day, whatever circumstances, whatever age for grown doesn’t mean nothing to a mother… for a child is a child is a child – they get bigger, they get older, they grow up, but to a mother’s heart that doesn’t mean a thing. For a mother’s love for her child is like nothing else in the world. It knows no law, no pity; it dares all things and crushes down remorselessly all that stands in its path. DE and Nanay Teresita including Mamang, joined forces, patched their differences for the love they shared for Richard and Maya and their desire for the happiness of these two beautiful people they had loved all their lives. For nothing would stand in their desire for these two to end up together so they will have that happiness both so deserve. These three matriarchs will do nothing to harm these two lovebirds and yet they will do anything and everything possible to make their dreams come true… for they will be behind them both all the way, every step of the way.
Zel MTo feel the joy of being a mother without mothering;
To feel the joy of being a teacher without teaching;
To feel the joy of being a friend without imposing friendship;
To feel the ultimate joy of knowing
that my daughter’s and my son’s dreams are fulfilled.
As Maya expressed her happiness and excitement at the thought of marrying SC, she couldn’t help but feel the anxiety, the fear, the uncertainty and the apprehension of her own readiness for such a life-changing event, of her dreams to give the best to her family and her own dreams. For while she was ecstatic, part of her had doubts if she’s indeed ready for marriage, ready to give up her dreams… asking herself if it’s too much too soon. Of which Nanay T, knowing fully well her daughter, understood her tears, her fears… calmed her down… comforted her… reassured her that while life may have other plans different from her own but what’s more important is what makes her happy in the end for what is her living a happy and contented life.
On the other hand, while Richard was anxious and concerned if the timing of his proposal is right for Maya, he thought of how her state of being might be, would she be ready at this point, would she welcome it with open arms… these thoughts were making Richard apprehensive of proposing at this time to his Mahal na Princesa. But with this apprehension, worry and hesitation, as much as he tried hiding it, he may just be as terrified of going thru the proposal not knowing for certain the answer Maya will give to his question, and not knowing for certain what the answer would be is eating him inside. DE, knowing fully well her son, as Nanay T had done, reminded him that it’s really not for him to decide but Maya…all she could do is be there for her son, reassure him, comfort him and gave him that warm hug and loving kiss that everything will work out just fine and offered her assistance for ideas for the proposal.
In the end, what DE and Nanay T only want the best for both Richard and Maya but most of all they want both to be happy, plain and simple. Thru it all, in whatever predicament the child may be in, a mother’s love is the most inexplicable love of all. She loves in spite of everything, hoping for the best till the last drop of life.
Sukiyaki 616Zel, this is a loving tribute to your Mom as I am sure you had her in your mind while pondering your POV and to all the other mothers. It heart to heart between Maya and Nanay T brought tears to my heart. Well done, Zel, hay naku, tinimbang ka ngunit sobra sobra pa!!
Cristy SantosOh ano Maya, “nawala ka sa sarili” mo? ikaw kasi, sabi nga ni Mamang ang “OA, OA” mo!! :)) :)). Kahit na panira ulit si Emman sa “moment ng sikreto” ni Sir Chief eh ok lang. sabi nga, “yun yon eh”.

Nagkulong sa kwarto nya si Maya, ayaw makipag-usap kyna NT…nagbubuklat ng scrapbook nya, at nagbabalik tanaw.
SC din, looking back sa kanilang love story… starting sa kiss nung prom.
Zel MSuki-san, don’t we all have soft hearts for moms… Sylvia Sanchez is a perfect fit to her role as the loving Nanay to Maya and Kute, she is one great actor… her facial expressions are what I always look forward to watching with her spot on delivery of her lines… all the emotions she can convey thru her eyes, her facial expressions, with the tweaks of her brows… very effective… thankie sis for reading my offering today…

SC is asking his mom, if it’s the right time na ba… for Maya.
Maya and NT talking na in her room… she’s asking if ready na sya, hindi pa nga daw sya nakakapag-around the world.
Awwwwwww, medyo may hesitancy si SC at Maya… may pangarap pa si Maya for her family, hindi nya daw alam kung napaaga ba ang pagdating ni SC sa buhay nya.
SC is thinking if hindi ba masyado maaga for Maya, sinabi naman daw kasi nya na hindi nya mamadaliin si Maya.
Piloy PgeMaya in trance, at least you did not became catatonic, from day dreaming to euphoric!!!!! JSM, you are truly a superb actress. You are able tp project all kinds of emotions. Funny and Heart warming episode.
Tears of joy …talaga pag BCWMH… kakainis, naiiyak na ako… heartwarming conversation of mother and son & mother and daughter.
2318 days agoEvangeline TasipitFun fun fun….todays epi is soooooo funny……Wow! Dona Esmi and Nanay T…..they anre such a wonderful parents……so supportive of their children…. Of course including Luke, Nikki and Babby Abby…..
So everybodys happy and excited….
Here webgo again…..Maya, the probinsyana, innocent….. Maya kalma lang…..I remember their first date, it was a disaster but cute….now baka yong ring eh nasa balut……ha ha ha……me myself can’t sleep thinking about it…..tooo many ideas flying in my brain……back to my blue pills again…..
Hot WasabiHello Kabsat,
Nakakatkatawa nga agpayso ni daytoy Maya. Hahaha. Saanpay nga nag propose tay maysa ket nakasagana tay sungbat nan. ha ha ha.
Alwadanyo ti BP ken puso yo. Blue pills ngarud! ha ha
Winnie R OntiverosToday’s episode is so dang funny in so many parts and so many ways. I could relate to some scenes in our story specially the different proposal assumptions by Mamang and Ehman. Just recently a friend shared the story of her proposal and today’s episode reminds me so much of her story. It was fun and funnier for me because of that. I just love love love our story no matter if typhoon Maring and her strong winds do nothing but criticize it. Just saying.
Ehman couldn’t help himself. He blurted out that Richard is about to propose to her. While he realized that he just told Maya something that is supposed to be kept from her, he apologized for doing so but it’s too late. It had already registered in Maya’s confused mind. She was in a state of shock. Ehman, Mamang and Nanay T tried to talk to her but she just stared at nothing. She didn’t speak or react. Eventually she walked inside her room still shocked. Nanay Teresita couldn’t help but pinch Ehman on his ear. (ha ha) He really felt bad for telling Maya Richard’s plan.
Doris and Sabel who were in such good mood, meet Richard at the foyer. They asked if he were hungry, they would get something ready for him. Richard said he’s done eating. The two left the room all giddy and happy. Manang Fe came down the stairs and met him too. Richard asked her what happened to the two? Manang Fe said that they are just too happy because they learned about his plans to propose to Maya. She assured him that the two would not let Maya know about it. (Yeah sure Manang Fe. You know those two are lose lipped? They can’t keep a secret for nothing. That is because Maya is their hero and if she is going to marry the rich, good looking and “mabango” {smells good} boss of theirs, it is something to keep them wishing for a fairytale for them as well.) Richard just shrugged his head. Manang Fe told Richard that she is so happy for him. Richard walked toward her and gave her a kiss on her head and said “this is it Manang.” She is so proud of Richard. (This scene just warms my heart.)
Back at the condo, Ehman apologizes to Kute for blurting out the proposal secret to Maya. Nanay T is updating Kute. She told her that Maya is in a trance, not speaking and doesn’t seem to be herself. She has locked herself in her room. They tried to speak to her to no avail. Nanay T requested Kute to try to call her to see if she will talk to her instead. Kute promised she will but for now, she feels Maya may need time to think so they just need to leave her alone. Inside her room, Maya is looking over all the memorabilia she nicely kept in a scrapbook to remind her of her journey with Richard. Along with them are memories reminding her how it was at the beginning. She remembered the first peck on the cheek from Richard the night of the prom; how giddy she felt inside like floating on air. Then she remembered the time when Richard first asked her out on a date. It brought a smile to her face. Richard, at the same exact time is sitting at the veranda having his coffee. He too is thinking of Maya reminiscing moments that remains fresh on his mind. He takes a sip of coffee and remembers Maya pulling his hand and running to catch the Ferry for their dinner cruise. While running, she dropped her purse but they had no time so Maya orders him to hurry up and catch the boat and stop them from leaving while she picks up her things on the ground. He remembers Maya running behind her with only one shoe only to find that the Ferry had indeed left without them. Richard also remembered the day that Maya confirmed and that they are now a couple. They were at Nanay Teresita’s most romantic place. At the very same spot where Tatay Arturo proposed to Nanay Teresita is when Maya confirmed that she indeed wants to be Richard’s girlfriend. It was such a sweet memory (that even I am still giddy about it today) It left a big smile on Richard’s face. At the same moment, Maya closes her scrap book of memories of Richard but she began to think of her own personal memories as a tour guide in San Nicolas, as Abby’s Yaya during her plight to becoming a flight attendant, memories with Kute and Cho, Nanay T and Mamang vowing to stay together forever. (I remember all of them Maya. It was such a fun ride with you.)
Winnie R OntiverosNanay Teresita knocks at the door to check up on Maya. At the mansion, Dona Esmeralda joins Richard at the veranda. She tells Richard that she is so grateful that after all these years, he has fallen in love again. Richard asks her if she thought this is the right time for Maya? At the condo, Maya apologizes to Nanay Teresita for the way that she was earlier. Nanay T said she understands her. Maya tells her mother that she didn’t understand how she felt at first. She felt like she is going to burst in happiness but at the same time she became afraid. The thought of marrying Richard sounded so good but she isn’t sure if she is ready for it? After all, she hasn’t even toured the world yet. That is her dream. She tells her mother that when she left San Nicolas, she only thought of one thing…to become a flight stewardess and help support the family. She didn’t know that she is going to meet Richard. On the other hand, Richard tells Dona Esmeralda that he promised Maya that he isn’t going to rush her into anything. Richard acknowledges that Maya is just now starting her career and he knows what a marriage entails. Dona E said that in a marriage, the priority is family over career. Richard agrees. He said that is what Maya has been doing all her life. Richard worries that this proposal might be too soon for her. Dona E said that is why he has to ask her. Nanay Teresita asks Maya if she thought Richard came to her life too soon? Maya said she doesn’t know. Nanay Teresita tells Maya, “Sometimes, there are things that come into your life that are not part of your original plans. You are going to get married and have your own family. Then your priorities will change. Daughter, there are things that you need to sacrifice. I know you have a lot of dreams for our family but you have to think of what is for you…what is going to make you happy.” “It is not for you to decide whether Maya is ready or not. Only she can make that decision. And besides, to start a family does not mean she will have less time for herself and her family. You are not going to allow that right?” Dona E asks Richard. He replies, “Of course not.” “And if she decides that she isn’t ready yet because of her fears, then if you love her you would understand.” Dona Esmeralda further explains to Richard. Meanwhile, Maya tells Nanay Teresita that Richard has been confusing her. She tells Maya not to force a decision. It will come to her in due time. She will feel it when it happens. Maya is in tears. She asks her mother when her father proposed to her if she thought about it? Nanay Teresita answered honestly and said that she didn’t. At that moment all she could think of is that she loves this man and all she wanted to do is to be with him and love him for the rest of her life. (Waaaaa! Tissue alert) She said she did it. It happened. She just does not know why her father gave up. At this point Maya may fear that the same thing could happen to her. Nanay Teresita assures her this isn’t going to happen to her. Richard is never going to leave her. “How do you know?” Maya asked. Nanay T said because Kute will hunt him down. Maya laughed while she cried. At the mansion, Dona E stands up and gives Richard a hug and a kiss assuring him that things will work out for him. She tells him she has a lot of ideas for his proposal if he needs help. Richard said thanks. Dona E tells Richard she just wants him to be happy. Nanay Teresita said, “But Maya, in all seriousness…whatever happens…whatever your decision may be, your family is here for you.” (Wow wow wow…this is in the top of my most favorite scenes in the entire show so far. Their acting is superb. Thank you for the supporting roles of Sylvia Sanchez and Marissa Delgado. Their chemistry with Jodi and Richard are perfect. Kudos to the casting director.)

Maya’s reaction is just natural, masaya sya na medyo takot… ready na ba sya? ano ba dapat gawin nya? is it the right time? pero syempre NT is there to show support and told her to think of herself, kung ano magpapasaya sa kanya.
Kuteeeeeeeeeeeeeeeeeeee….relax lang daw si Maya, baka daw mag-OO agad eh hindi pa nagtatanong si SC.

Good mood pareho ang dalawa…early morning call, about the dinner…ang mga audience, listening attentively glancing to each other… excited sa proposal.
Love is in the air!
Niknik in the library, so G R R R R -ing because of the makulit na Niccolo texting her… with Amiel on the other table.
Yvette TanSuper love it!!!! So inspiring to watch both families….all out support sila talaga….nabaliw naman ako sa teaser so funny…super excited for tomorrow…..I’m guessing its not gonna happen this week, Ms. Abueg left for Europe so we have to wait until she gets back which means SC doesn’t have the ring yet.
Love the way our dear creative team keeps me glued all the time…..Maya kalma……naloka naman ako sa yo…YES na YES ka talaga nakita mo lang nakaluhod si SC…….hmmmmmm……just wondering what if SC did ask…..hmmmmmm, impossible! wala pa nga yun ring! ( o kitam pati ako para ng si maya, kinakausap ko na rin sarili ko LOL)……hay naku BCWMH….naku naku kakabitin naman kayo…..Love u!
DE preparing the vitamins and food supplements, dadalhin daw kay Mamang and NT sa condo. Kasama nya pupunta si Manang Fe —- para raw sila mamamanhikan na.
Okay na si mamang at DE, may beso beso pa… nakakatuwa sila… parang feeling ko ako si Maya… I am happy na okay na talaga sila.
Sis, kilig-kilig and also feeling overwhelmed kasi sabi nga ni Maya, ang perfect na ng lahat… can’t wait na for the grand proposal.
Winnie R OntiverosZel, i haven’t seen the episode tonight. Nakatulog ako e. i just woke up because my husband came home. I realized it is past midnight and i know the episode is probably already loaded but here i am. I want to read your post first and foremost and don’t want to miss it. I am glad I did because it is definitely worth the few minutes. Thank you for your pov. The mothers of this world indeed could be someone’s best friend and in times like the one that Maya and Richard are going through, it is nice to have that Mother that could be there with you through it all. As much as i understood every apprehension and tension that Maya is feeling, i did not think of what Richard could be worried about. I knew that he was worried that it may be too soon for Maya but i never thought that the uncertainty would make him nervous enough to do what he is about to do. I wonder if all man go through that feeling? That what if she said no? I didn’t even worry for Richard at all but I could only imagine.
Tanks again Zel. Please do not stop posting such great pov’s that make me think, that inspire me and that slaps me back to reality.
Bernie RoqueI couldn’t stop laughing watching the teaser. Talk about excited…hahaha! Maya like you said “Kalma lang.” Wait for SC to propose. Pero I guess sa sobrang excited, napa-OO ka na ni SC without even asking the question. You are sooo cute…”Yes! Yes! Yes!…”
I still think Emman shouldn’t have said anything. It not only ruin the surprise but now Maya will be tulala until SC finally propose. There’s goes kilig moment…lol
Nikki my dear I am proud and happy you didn’t act like brat when you found out that you are not the only one who is going to help Nicolo. At the same time though I know you would like to avoid him as much as possible but I think in this case you should help him even with Cheska in the picture. Just keep telling yourself that you’re doing this for Nicolo’s mom and not for him. That might make you calm enough and not go torete on him…lol.

Naloka ako sa teaser…………….waaaaaaaaaaaaaaaaahhhhhhhhhhhhhhhhhhhh.
Maya sinabi na ni kute di ba? Wag excited!!!! Nag-YES na e wala namang tanong
tingin ko, guniguni lang yun ni Maya na lumuhod si SC.Baka mapahiya si Maya sa pag-yeyes niya at mabuking siya ni SC na alam niya na!!!
G. IsaacsToo funny. That is Maya when she is nervous. That’s more like her typical hyperactive self. SC is so considerate and thoughtful to think if it’s too soon. Maya landed on cloud 9 and her dreams be dam***. She has always liked SC so I presume she will put her dreams aside for now and will be ok if it takes a detour for her SC. NT and DE are sweet mothers and on point. They exude happiness and gratitude. Better acting except SC is still a little uneasy looking people straight in the eyes. I like these roles for Maya ‘coz she is more natural in her being funny when anxious and nervous. As with SC, ride the wave na lang ako. I look at the picture on the website for the show and it reminds me of the dapper SC in his metallic suit. That was a reason why I started watching this show. I knew nothing about it before that. There’s not much the writers can do to twist the story because like Maya puts it “Sa hinaba haba man daw ng prosesyon, sa simbahan pa rin ang dating.” I must admit, I am pretty fond of the earlier episodes when it was so full of innocence and laughter. I watch those when I’m at an airport or bored or when I need to purge my closet. Young Maya did not have but a few set of clothes and was perfectly fine.
I have seen so many proposals around me both total surprises and some somewhat expected. Each one is a special as the other but man, people nowadays are really creative with their proposals. One young (college age) friend hired a videographer and photographer who had to be in hiding to capture the actual engagement and this happened on a university campus under an isolated tree with a swing far from anywhere anybody can hide (let alone take pictures and video). Well, it turned out great and the couple ended up in a bridal magazine for Tacori engagement rings as the best proposal ever. Who knew? Anyway, sorry for the side story.
I can’t help but ask, is Maya cheated of a once in a lifetime experience by knowing about the proposal? Yes, it is funny to watch all her misadventures and such but in all seriousness, would her reaction be priceless if she indeed was genuinely surprised? We’ll never know. All I know is it won’t matter after the fact.
On today’s teaser:
Mukhang maidadagdag sa most embarassing moment ni Maya yung nasa teaser ah.
Waaaaahhhhhh bat napaluhod si Singkit?
Huy mamang singkit, tini-tease mo talaga kami ano? Nahulog lang yata yung car keys mo kaya ka napaluhod dyan eh!
teaser:
Dinner date (eto po yung BTS dito na may baso)SC noticed during the dinner na may kakaiba kay Maya…. kasi nga aligaga…(I assumed nag-CR si SC) si Maya lang sa table, on the phone with the people sa condo, andun din si DE at Manang Fe, naka-monitor
Hot WasabiNERVOUS ANTICIPATION
Now that everyone knows that a proposal is impending, Richard’s every move is being scrutinized to the minutest detail. Everybody is eavesdropping on his telephone conversation to get a whiff of when he is going to pop the question and where he is going to do it. The entire Lim household is on their toes as they try to confirm his next move to ascertain when it might happen. Likewise the viewing community is collectively holding their breath in anticipation of the main event.
On the other hand, Maya is being coached to look out for the signs of when “IT” might happen.
1. Emman cautions her to be careful with her food so that she does not ingest the ring, just in case it is hidden in the food.
2. Mamang advises for her to be careful with the drink as he may drop the ring in it.
3. Nanay Teresita tells Maya to be on the lookout for Richard’s move. She informs the latter that when Richard will drop down on his knees, this is the sign that he will definitely ask her the most awaited question of the week, if not her life.
With Maya knowing that Richard will propose to her, she finds it impossible to relax. Consequently, she is so nervous, high strung, excited, and anxious. Her senses are calibrated to high alert. She feels that she is so ready and so aware of the telltale signs of when IT might happen that her reaction time is keyed to snap at the slightest hint that it is forthcoming. It is so hilarious to watch her examine her food to look for the hidden treasure buried within. At the condo, Sir Chief had to get down on the floor to pick something up and Maya immediately assumes that he is going on his knees to propose. Hence, she excitedly exclaims in rapid fire response her positive answer to a question that has not even been asked yet! It is such a hysterical scene!
The brilliant writers of this drama who are aware that its viewing public vicariously experience their emotions through Maya has effectively got them exactly where they can manipulate their reaction to the scenes the actors are portraying. They are so successful that even the subscribers to this drama who has just been contented to silently watch from the sidelines now feel compelled to share their positive reaction to the episodes. Such clever manipulators! They are so skillful and shrewd in their tasteful maneuvers in playing with their emotions.
Another brilliantly plotted episode. Bravo production team! But please be careful with our hearts! Dahan dahan lang baka maraming aatakihin sa puso sa mga pinaggagawa niyo. Hahahahaha.
Actually okay lang yun kasi you are actually giving our hearts its much needed aerobic workout! The torete scenes with Maya enduces just the right aerobic exercise so that we can consider it to be a laughing yoga session. Hahahahaha.
‘Baka naman hindi ngayon, magpo-propose si SC’ – Maya
Nag-SOCO na nga si Maya pati yung food…’nag-dessert na ba kayo? – DE
So, I think cake yung isang na-SOCO ni Maya.Then, hatid na sa condo sa may harap ng elevator…paglingon ni Maya, medyo nakaupo or luhod si SC, so obviously (for me) may pinupulot or something pero kay Maya, akala nya proposal na, and then mega-YES ang prinsesa.
Ano kayang pasabog ni singkit? Lakas kutob ko na pati tayo gugulatin sa style ng proposal nya.
Evangeline TasipitMinkie HW…..you are absolutely right…. The writers knows how to make us think in advance….especially in a positive way….that’s why I’m soooo addicted to this show……and of course to my Ser Chief!…..
Thanks for the beautiful review!
Eto namang Mayabels yume-yes agad, di pa naman game.
Napatakip ako ng mukha sa pag-YES ni Maya, dyahe much ako for her nakakaloka talaga ang show na ‘to.
Excited din ako kung paano sya lulusot dyan… but I’m sure may maiisip yan… trained naman sya nung nasa mansyon pa sya eh… hindi sya nauubusan noon ng palusot kay SC nya.
I don’t know if I’d wish for SC to remain dense or for him to have a clue that Maya knows.If he remains oblivious, ang saya lang ng hula game ni Maya!
But if he’ll have an idea, he can change plans pa and make it as bongga as ever. He doesn’t have to fear rejection cause technically Maya already said yes.
My whole week is so much more fun dahil sa episodes nila!
Nag replay ako ng episode today…ngayon ko lang napansin na kinurot ni NanayTeresita si Emman sa tenga! Hahaha… buti nga sa kanya.

Nakita ko na naman yung Yes ni Maya sa teaser, hiyang hiya na naman ako.Pilyo pa naman si SC, simpleng mang-asar.
Naalala ko yung scene na hinati ni SC yung sandwich. Akala ni Maya para sa kanya yun pala ipapatago lang baka pati proposal aabot pa ng isang buwan na puro hopia!!!! Pati tayo neto magiging aligaga na kagaya ni Maya!!! Kung sa Resorts World nga ang proposal, parang simple dinner lang naman ang setting!!!
Winnie R OntiverosMiss hottie….haaayyyy you are so dang right about the creative writers. They are not called creative for nothing. I don’t mind being manipulated like this. This is fun. Even the serious parts of the episode today is tamed but it hit the spot perfectly. I teared up at Maya and Nanay T’s conversation and for the first time, Dona Esmeralda is effective in her guiding Richard. Much like what Manang Fe would do, she gave him assurance that what he is doing is the right thing. Does she know what Maya’s answer would be? No she didn’t but she encouraged him anyway because she said it is why it is a proposal. He will have to ask that question to Maya. Ang galeng talaga. Tank you sis for your summation and no argument from me. Luv yah.
JR RHAHAHAHAHAHAHAHA…naunang mag yes si Maya before SerChief’ even uttered the magic words….HINIMATAY AKO sa TAWA MUNTIK NANG MALAGLAG SA KAMA KO…..HAHAHAHA. It is highly unlikely that the proposal took place at the condo’s lobby. It’s not gonna happen this week. The writers will take us on another week-long journey killing us with anticipation but that’s okay. It’ll all be worth it! Yayyyyyyyy…
The conversation between mother and daughter and mother and son are the high points in this episode. They have provided words of wisdom and guidance to the two. Mothers are always there to give us proper perspective of life. They hold our hands for a short while, but our hearts forever. ” The future destiny of a child is always the work of the mother”-Napoleon Bonaparte.
Napaka-supportive naman ng ‘Team Maya’ sa pagiging assumera niya. Talagang tinuturuan pa sya anong pagkain ang bubulatlatin!
Big thanks to Emman kasi kung sakaling di niya pala sinabi kay Maya, pagdating sa proposal, malamang her reaction will be nganga, tulaley, walkout!
Also, welcome back Maya the Assumera! With a team pa talaga.
I am hoping na ang scene na yan ay kagaya nung scene ng unang pag-amin ni Maya na crush niya si SC…na panaginip lang pala! Pero may advantage rin na alam na ni SC kung ano ang isasagot ni Maya sa kanyang proposal, bumawi na lang siya sa actual na proposal!!!
Kung maka-YES naman itong si Maya, wagas! Excited ako sa magiging reaction ni SC at kung anong gagawing palusot ni Maya. Kasi naman eh, sobrang atat lang din ng mga nasa condo sa proposal na yan!
Editha GarciaThe mother’s heart to heart talk is very inspiring. No matter what happens, a mother’s love is there forever. Maya is so funny and over excited for the upcoming proposal. Kaloka ka Maya, yes agad.
To the writers and director, thank you for always making us smile.
Eunice Kim Bambalankilig much ang episode today!!!!!!!!magmula nun mag on na cla ser chief at maya na oa han na ako sa knila wala na kilig factor but i still keep on watching sa wakas this past few days you make the kwento much kilig again luv it much.more power sa cast and crew specially sa writers ng show hope you can create more kilig scenes/kwento in this show!!!!
Yes. Mas confident na si SC kasi alam na nyang magye yes si Maya kaya pwede na nyang gawing super bongga ang proposal.
Dapat lang talaga ma-exceed yung highest expectations nating mga adiks! Parang satin magpo-propose eh.
Hanep, lagi maaga ang teaser ah…sana sa kasal guest si Jose Mari Chan para kantahin ang theme song…baby… wedding.
E-Queue Ox4dOh… my… G! Natatawa ako na naluluha sa teaser for tomorrow’s episode… Natatawa kasi kung makapag-“YES, YES, YES SIR CHIEF KO” si Maya… WAGAS!!! LOL! Akala mo may tinanong na si Sir Chief eh “Maya…” pa lang naman ang sinabi…Naluluha kasi I’m SOOOOO EMBARRASSED for her… Anu kaya ang pambawi ni Mayabels sa recent additional “most embarrassing moment” niya??? Maya, ang puso mo… kalma… Be careful with your own heart… Abang-abang din pag may time… LOL na LOL talaga!
Ay kaloka ka lang Maya! excited nag – Yes! for sure laugh trip bukas. Maghihinala si SC na alam na ni Maya. I dont think naman sobrang mapapahiya si ya,makakalusot sya. I guess yung proposal bigla at pati tayo magugulat.Yung tipong hindi iexpect ni Maya dahil sa daming hopia na mangyayari sa kaka expect at assume nya.
Kita ko na naman ang teaser…”Yes, YES SIR CHIEF KO, Yes…”
Nakakaloka… how can Maya escape from that humiliation… wait and see na naman tayo… knowing Mayabels, malulusotan na niyan…hindi kasurprise-surprise kung si Ser Chief ang lumuhod infront of Maya. Ang kasurprise-surprise if it is the other way around.
Tita Samaniegohayyyyyyyyyyyy, kaloka si Maya wala pang tanong si sir Chief, sakit ng tiyan ko sa katatawa….ang cute ng episode na ito, thanks BCWMH samtambak na kaaliwan at kilig,,,,
Sa tinagal ni Sabel sa mansyon, was that the first time na pinuri ni Ser Chief ang luto ni Sabel?
Body-body na sina mamang at donya Esmeralda, ay! buddy-buddy pala.
I saw pictures sa IG na may hashtag na bcwmh. Mukhang nasa Manila bay ang taping nila ngayon.At I really feel na matutuloy ang naudlot na cruise dinner date ng mag jowa. At sana doon na din ang proposal.
You’re right, the progress of the relationship is certainly coming along, therefore, we can also see the progress in which they show their affection into somewhat a more comfortable level as well as the frequency of the kisses. Talagang nakakilig. I’m looking forward to more as they become husband and wife. I wonder if they are going to tackle a pregnancy in the movie version, SC mataranta when Maya is in labor, laughtrip talaga yan.
Evangeline HenriksenHay Maya de Larosa wala pang tinatanong may nalaglag lang nag yesss kana..ok lang ako din excited na rinn hihi….
Sweety Pie“MAYA DELA ROSA LIM” haaaaaaaaaaaaay (scream to the 100th note..) Both families are all out support for SC & Maya hoping that the
W Y M M ? will take place on their dinner date..We don’t think so… So..so.. funny this proposal thing is turning out…the ride is in reverse…
so viewers hold on tight… In teaser “FIND THE RING DINNER DATE” is taking place… super hilarious next epis..can’t wait …
Again TYVVM…to all BCWMH casts, writers, crews, directors and all.. BRAVO !!!!
I guess we just have to savor every moment while it lasts. Another good thing about this show is that kahit paulit-ulitin mong panuorin, andun pa rin ang kilig, kaba, inis, lungkot, tuwa at kung-anu-ano pang damdamin… so this would sustain us pag dumating na yung panahon na yun.
I’m just so glad however that ABS-CBN management is seriously considering options as to how they can make this show last ‘forever’. (Believe me, they do and we know this naman.) We also know ‘forever’ is just a figure of speech (siyempre, hindi naman immortal ang cast kahit ano pang gawing extension sa show ), but I know that they really mean to make BCWMH an iconic show in Philippine television (and as it is now, iconic nanaman talaga!).
Cynch HonradoHilarious anticipation all around. Excited much!
The mother-daughter and mother-son scenes are so apt……both show the best of both mothers; Nanay Teresita with all out support, telling Maya that what is important is her happiness and her family is just there for her and Dona Esmeralda being grateful and happy that Richard loved again and telling Richard that only Maya can answer if she is ready or not and if she is not ready, if Richard really loves Maya, he will understand.
Kute telling Maya to calm down as she might say yes even if Richard has not asked her yet…….OMG, on the teaser it would seem Maya did say yes….but wait, is Richard really proposing?????? Or because of the anticipation of the proposal, Maya is oblivious of anything else except the proposal, distracted too much……aligaga????? , but that’s a teaser and there are omitted scene(s) to complete the scenario that will mislead us viewers – the writers are so good they’ve really got us guessing even if we do not want to. I guess Richard’s statement of “nothing comes according to plan with regards to them” is true.
How nice that Dona Esmeralda is reaching out, and thank God Mamang even in jest is also being nice. Dona Esmeralda having Manang Fe with her for the visit is touching. Now they are ka-pamilya!
with two more episode for this week, hay naku writers what have you got in store for us?
Edz is being teased, but Maya is preoccupied with SC, so she has not connected Simon’s statement yet…..though she absorbed the gist of the conversation of her fellow FA’s……I am still hoping that Maya will be the bridge for Simon and Edz.
Richard compliments Sabel for the omelette…….the result of Sabel’s culinary lessons. Even in past episodes, Manang Fe has complimented Sabel for the food she cooks for the family. Even with baking, she has helped Nikki, giving pointers of what she has learned in school. Good job Sabel!
Now Nikki is feeling guilty….what are you going to do Nikki, you still have the chords for the Terrified song that you arranged for Nicolo’s music video. Will you decide to help now that you know it is for Nicolo’s mother?
I hope if Luke helps Nicolo, the mtv will not be disqualified because they are batch-mate unless it is just arranging and not part of the mtv.
Jo EThis episode is full of love between mother and daughter and mother and son. The talk between Maya and NanayT and Ser Chief and DonaE is so heartwarming. Ser Chief hugging and kissing Manang Fe is so touching. Maya and Ser Chief are so lucky to have mothers that love them unconditionally and act as their sounding board. They are there to listen, support and give them advise.
Emman telling Maya about Ser Chief’s proposal is a blessing in disguise because Maya is given a chance to acclimatize herself with the idea and talk to NanayT about her fears and dreams not coming to fruition if she get’s married. She’s given time to think of her priorities and how much she loves Ser Chief.
In the end she is so ready to say Yes even though Ser Chief hasn’t utter the words yet. It is so funny, she’s already saying Yes, and Ser Chief is probably picking up a loose coin or tying his shoe lace. Kute was right when she told Maya not to get so excited because she might say yes before Ser Chief proposes.
Mamang and DonaE are so sweet, their animosity towards each other forgotten because they are going to be one family. The Lim and delaRosa household are all united as one family for Ser Chief and Maya.
Thank you so much BCWMH team for bringing us another episode that reminds us to love and care for our family. And for triggering poignant memories.

#SanaHanggangBook100PaAngBCWMH#
#HanggangMagkaApoNaSinaMayaatSerChief#
#HanggangMagRetireNaSiAbby#
#NextJohnAndMarsha#
#forever
@imEliesa24 10h
Pusoo koo!! C ser chief and Maya nsa Sun Cruise Manila Bay…ohMyGee!! Anong nangyayare!! #becarefulwithmyheart
Winnie R OntiverosLater that evening, Maya keeps tossing and turning. She couldn’t sleep still thinking about Richard and the proposal. At one point, she stops to think about the future. She listened to her voice say her name Maya de la Rosa Lim (Weeeee! Sounds good to me.) It made her smile. The following day, Leno asked Kute what the fuss was all about Cho becoming a ring bearer. Kute shrugged him off and wanted him to stay off their business. He was insistent and continued to follow Kute around while she calls up Maya. Over the phone they do their sisterly talk. Kute made Maya promise that Cho will be the ring bearer. Maya said he hasn’t asked yet. Kute tells her not to worry it is going to happen. Maya tells her she is worried that she is going to faint specially after she heard what happened last night. Maya assured her that was just temporary insanity ha ha Kute warns Maya to please keep herself in check. She might say “yes” even before he actually pops the question (ummm Kute you are a fortune teller are you?) Leno overheard this and started to go ape sh** over the thought that Maya is getting married. Bugoy, eavesdropping in the background hid behind the wall scared of Leno seemingly about to do “huramentado” (go berserk, possessed, run amok) Maya hears this and asks what’s happening? Kute tells her it’s Leno going ape crazy ha ha
At the mansion, Richard seems to be in high spirits. At the breakfast table with his parents and kids, he asks for the omelet. He gives himself a huge helping and started to eat as if he’s famished. (He ate like my boys, pieces of rice flew all over the place) Richard asked Sabel if she cooked the omelet. She said yes. Richard said that it tastes good. Luke notices and whispers to Nikki that if she needs anything, now is the time to ask his Dad. She looks at Richard and smiles. Richard takes a big gulp of his coffee and then he excuses himself from the table. Everyone was quietly observing him. He walked a few steps over the other side of the divider. He calls up Maya. Meanwhile, at the condo, the four are also eating breakfast. Maya is now in good spirits. She was chewing and daydreaming. Mamang was talking behind her back to Nanay Teresita and Ehman but I couldn’t make out what she is mouthing off. For the most part, they just sit there observing Maya. Suddenly, Maya’s phone rings. Still daydreaming, she answers the phone not knowing who is on the other line until she hears Richard’s voice. “Ser Chief?” she said. Her demeanor changed. Richard asked how she is this morning? Maya answered that she is just fine. During this conversation, everyone at both houses is listening. Richard tells Maya that she didn’t look ok last night. Maya told him she’s fine now. Richard proceeds to ask her if she wants to go out tonight to dinner. Dinner? Maya said. Ehman reacts loudly. Nikki, Luke and Abby got excited. “Yes” Richard said. “I want to make it up to you over what happened last night. Are you doing anything?” Everyone eavesdropping is excited by this time. They almost couldn’t contain it. Maya said, “No I am free. Where are we going to have dinner?” Richard said, “I was thinking some fine dining.” There was another reaction from both groups. “Fine dining?” Maya asked. “Where?” Richard said he will be in charge of the arrangements and he will see her later. They hung up the phone.
Ehman screams. (uh oh, here comes Ehman again with his ideas ha ha oftentimes he is “sablay” {he misses}…) He tells Maya to make sure to check the food. Maya asks why? He thinks Richard might put the ring on the food. (Bwahaha this sooooo reminds me of my friend. But she had no idea so she didn’t inspect the food. Thank goodness the ring wasn’t there.) Mamang pipes in and said he could put the ring on the drink. What? Maya asks again. Ehman warned her that if she isn’t cautious, she might gulp down the ring (Oh my G then Maya will be choking ha ha) Nanay Teresita thinks Richard doesn’t go for gimmicks like that. She thinks he will suddenly just get down on one knee. Ehman continues the thought that Richard will then serenade Maya while proposing. He is so excited he is clapping on his seat (bwahaha I soooooo love Ehman even though I want to “kutos” him sometimes. {kutos means giving a knuckle blow on the head} ) Maya just couldn’t get over the possibility of a proposal from Richard. She is excited.
Winnie R OntiverosAt the high school, Nikki gets a text from Nicolo begging for her help with the music video. Nikki was inside the library and when she was about to reply to the text, Amiel sees her and warns her that she is not allowed to use the cell phone in the library. Nikki still has not warmed up to Amiel. At the university Louie asks Luke where Nicolo is? He tells him he’s outside texting Nikki begging for help with the music video. Louie said that Nicolo only wanted to make a good music video because he wants to impress Cheska. Luke corrected Louie and told him that Nicolo’s video is also for his Mom. “You know he is a Momma’s boy” Luke said. They both laughed. At Time Airways, the boy FA’s were talking to the girl FA’s. They are telling Edz that she is once more “single and ready to mingle” again. They want to know if they could fix her up with some of their friends. (Nooooo! Stop it boy FA’s! She is touch move for Simon!) Edz said no. She isn’t interested. The others agree. They think that sometimes it is good to remain single…right Maya? They directed the question to Maya because she is daydreaming again. (While the others are thinking single, Maya is thinking getting hitched ha ha) She suddenly snaps out of it. The girls asked her if she heard what they were talking about? Maya said yes, it about fixing Edz up with someone. Edz said no. She does not want to. They all laugh.
At the mansion, Dona E is preparing the food supplements and fat burners to take to Nanay Teresita and Mamang. She is trying to wrap it in ribbons and in to a nice bag. She is trying to reach out to NT and M to Don R’s surprise. She is taking Manang Fe with her. (Another point to DE for she really keeps reaching out to the de la Rosas) Meanwhile, Mamang and NT are walking back to the condo. NT told Mamang that she is going to have to take her medicine in front of her per Kute this way they are sure that she is indeed taking her pills. Mamang agreed to NTs surprise. Mamang said she wants to get better in preparation for Maya’s wedding. Suddenly, DE arrives with Manang Fe. They said their hellos and DE and Mamang kissed one another. They are obviously burying the hatchet for the sake of Richard and Maya. They both acknowledged that they know about the proposal and they are happy that they will become a blended family. They happily walk together upstairs.
Nikki arrives home and surprised to find Luke. She thought he had a meeting with the M&S group? He tells her they allowed them time to practice individually instead. Nikki tried to see if Nicolo was with him. Luke tells her he was supposed to but Nikki never responded to his text messages so he didn’t come. Nikki said, “Why would I want to help him to impress Cheska? He isn’t you Kuya.” Luke explained to Nikki that Nicolo wanted to make the music video perfect because he wanted to give it to his mom as a gift. His mother happens to be Nicolo’s biggest fan and she watches his videos when she is feeling homesick while she is abroad. That information seemed to tug at Nikki’s heartstrings. She became solemn. Luke tells Nikki it is ok, he will help Nicolo. (Niknik come on…please help Nicolo. You know he has crazy ideas and his music video will never be a good one unless you help him.)
At the airport, Maya changed to her civilian outfit getting ready for her date with Richard. Edz walks in the bathroom and sees her looking great. She asked if she is going out on a date? Maya didn’t answer right away. Edz noticed and asked her what’s going on? She seems distant and distracted. Maya didn’t say anything. She looked at the text message on her phone. It is Richard saying he is waiting outside. Maya walks out and she sees Richard standing there. She stops and stares at him for a moment. Could is the man that she is going to marry?
Oh ano naan yang ginagawa nila dyan? dyan ba yung hindi nila natuloy na date kasi nalate sila?
Thanks Ms Cutie. You’re right, the progress of the relationship is certainly coming along, therefore, we can also see the progress in which they show their affection into somewhat a more comfortable level as well as the frequency of the kisses. Talagang nakakilig. I’m looking forward to more as they become husband and wife. I wonder if they are going to tackle a pregnancy in the movie version, SC mataranta when Maya is in labor, laughtrip talaga yan.
Ano kayang pasabog ni singkit? lakas kutob ko na pati tayo gugulatin sa style ng proposal nya.
Eto namang mayabels yume-yes agad, di pa naman game
#NaiihiSaSuspense#
#AkoNahihiyaSaPagYesNiMaya#
SaLoves GemOh My Geee….I feel na may isa dyang maho-hopia sa sobrang pagka-assuming niya…well sana mali ang mga iniisip din natin and I don’t know what the writers instore for us sa tomorrow’s episode…hoping lang na maging natural at kalmado ang acting ni Maya everytime na may dinner date sila ni SC at huwag muna siyang mag ala-ring hunter or magpadala sa mga advises ni Emman…you just can’t blame her ang dami din kasing estuserang nakapaligid sa kanya kaya siguro naguguluhan na rin siya 🙂 For tomorrow’s teaser….I don’t know how to react kung matutuwa ako o mahihiya ako sa reaction ni Maya kaya kung sakaling magkatotoo ang sinabi ni Kute sa kanya patay!….dagdag na naman ito sa most embarrassing experiences niya kaya mamaya pagpatak ng 12AM hindi ko muna panoorin ang episode aabangan ko na lang ang summary ni Ms. Winnie at ang mga reviews niyo para mai-handa ko ang sarili ko 🙂 Baka naisip ko hindi shoe lace ang inayos ni SC baka hindi namalayan ni Maya eh ibang kulay ng sapatos ang suot niya or may butas pala ang isang shoe niya….hay nakuh hanovayan!!! but I also love the convo of Maya & NT and SC & DE with MF to give them heart warming, motherly love advises at least I heard Sir Chief’s side regarding the promise he made to Maya na hindi niya ito mamadaliin at satisfied naman ako sa mga sagot ni DE sa kanya…kaya kita-kitz ulit tayo dito sa forum! Let us all enjoy the roller coaster ride for the much awaited proposal…love…love…love!!!
Thanks for the updates. Seems we have another good epi today and another epi to look forward to tomorrow.
Well, kahit di ko pa nakikita, ako rin ay napapatakip ng mukha sa wagas na pag-YES ni Maya. Pero the bright side of this is… alam na natin na YES agad ang sagot ng ating Mahal na Prinsesa kapag nagtanong na ang ating Mahal na Hari.
Ataters lang talaga Mayabels! Lafftrip ang hinahanap ang ring sa sushi at sa cake! Parang food inspector ang peg!!! Hahahaha
Epic fail ang elevator scene dun sa condo….nakaluhod si SerChief (looks like he’s picking up something on the floor) si Maya kung maka YES naman ang wagas!!! hahahaha
Can’t wait for tommorow episode!!
Sabi kagabi gusto ni Tom na bumalik bilang Papa Pards sa series at movie
Sana nga matuloy
DENNIS VILLACORTELike the previous reviewers, I am extremely masaya about this episode. I especially like the flashback scenes, of Maya and Sir Chief’s courtship, her life back in San Nicolas. We reminisce about all that she’s been through, that they’ve been through, reliving all the kilig moments. Maraming salamat BCWMH for the gift.
Hi sis jeep! Sana laging ganyan balita sa ABS no and not about ****.
Honestly, I would love Tom to be in the movie pero as to him returning permanently sa series, hati ako. My heart says yes but my mind says no… Would be unfair for those who stayed sa show and were there during its down time. Guestings would surely be OK. I also don’t think a return would be possible for him at this point kasi he is under exclusive contract sa kabila sa pagkakaalam ko…
Gusto ko lang manawagan kay Mayabels …
Kasi sa sobrang bilis ng mga pangyayari nalito na yata sya. Maya, ang sagot ay hindi nauuna sa tanong. Hintay hintay din muna ng tanong pag may time … bago sumagot
#JellyDeBelenAkoKaycjmLIM#
#BakitBiglaKangNagingLim#
Manny RamosI’m amazed how the entire cast can make this teleserye look so real and very realistic .. gagaling nilang umarte…Sylvia Sanchez is great likewise Marissa Delgado (won 2 FAMAS) , Gloria Sevilla and Noel Trinidad. Divine Valencia (I got her personal autograph when I was in my second year in college at UST) She’s one of the sexiest actress Philippine Movies ever produced, saw all her movies with Jess Lapid)! Pati yung mga kids (Luke, Nikki and Abbey) they are so good and wholesome kids….
Curious ako pano lulusutan ni Mayabels ang embarrassing moment na ito…
#MissAssumera2013NaExcitedMagingMisis#
Excited din ako kung paano sya lulusot dyan… but i’m sure may maiisip yan… trained naman sya nung nasa mansyon pa sya eh… hindi sya nauubusan noon ng palusot kay SC nya….
I don’t know if I’d wish for SC to remain dense or for him to have a clue that Maya knows.
If he remains oblivious, ang saya lang ng hula game ni Maya!
But if he’ll have an idea, he can change plans pa and make it as bongga as ever. He doesn’t have to fear rejection cause technically Maya already said yes.
My whole week is so much more fun dahil sa episodes nila!
#GVsupply
#anglepsbakamapunit
May tiwala ako kay Maya…malulusotan niya ang YES moment niya and maybe because of that SerChief will notice that Maya knows na about his plan to propose so he has to think of a better plan na…confident lang ako that he’s not proposing YeS coz the ring is still being made diba?

#cjmlimTALAGA?
#cyberowlYAP???
#KUTEFFparin
#WalaPangTanongMayaYESagad?
Notice Mayabels left hand… she is already wearing a ring… ito na ba yong platinum, round cut diamond, 0.5 carat, grade D (colorless), in 6 prongs, size 6… I think so… the proposal has already been done… huhuhu! you dont do that to me…
Jonmarc BuendiaSuper ganda na ng serye! …. Grabe maya ha kung maka Yes wagas!!! Baka nagtali lang ng sapatos kaya nakaluhod…. Hehehe lolz ! Excited tomorrow 🙂
CTO
#walanatalagangpagasakayrichardlim
#kayrichardyapkaya
#spellasa
Oh My Geeeeee! napalingon lang ako,engaged na si Maya??? Ano ba yung damit nila sa RW na scene??? Hindi pa yata sila nung nakared na blouse si Mayabels!!! May picture ba tayo ng sa Resorts World sila?
Engaged na si Mayabels sa pic ni Doc!!
Iara FamilaraMalamang may nalaglag lang itong si Maya kaya tinawag s’ya ni Ser Chief, pero ang sagot…
Naman… Bonggang bongga!! Kaloka talaga! ❤❤❤
Sooo ano ba talaga ag nangyari sa proposal???
Suspense masyado!!
Oh My Geeeeeee… they’re ENGAGED!!!
Wait…. bakit ganyan ang tingin ni Mr. Lim
#InggitMuch
Grabe ang tingin! tinititigan pano mag-lipstick si Maya or iniisip nya na maalis din yang lipstick pag ni-kiss nya
Winnie R OntiverosNext Time on BCWMH
At the restaurant, Maya continues to be distracted thinking of what Ehman, Mamang and Nanay Teresita were saying about the proposal. At one point she excuses her self to the restroom. She needed to self talk because she is losing her mind. At the condo, Nanay Teresita is heard telling everyone that maybe Richard isn’t proposing just yet. Mamang tells her to think positive. Dona E says she is just guessing. She really does not know. Meanwhile, Maya is checking the sushi for sign of the ring. (Ha ha this cracked me up. You are so silly Maya) At one point, Richard calls Maya and said, “Will you…” Maya reacts to this. She is ready. “…tell me about Mamang?” Richard said. Maya’s face soured. (ha ha I am ROFL) In the next scene, Maya is talking to Nanay Teresita. She tells her that maybe he isn’t going to propose just yet. So it appears that Maya has reserved the thought of the proposal for now. She is seen talking away and in good spirit walking out of the restaurant ahead of Richard. When she turned around, she sees Richard down on the floor. He looks up to her and said “Maya…” She looks down and all of a sudden she jumps up and down and said “Yes my Ser Chief Yes Yes Yes” Bwahahahaha!
Connie StubbsNaku Maya, Yes na agad! Daddy Singkit is just doing his shoelaces :-)) I can’t wait for tomorrow’s eps. I’ll be missing this show when it will finally end!! I’ll be having withdrawal syndrome.
Nanay Teresita is the prefect Nanay in the whole wide world. She’s so sweet in the way she explains Maya. But I do have my resevations about Maya getting married right away without actually enjoying her single status. She hasn’t fulfilled her longlife dreams yet of touring around the world with her family. I hope she will still be able to do it before she finally ties the knot because when she get married, all her priorities will be shifted to her new family.
Thursday, August 29
Kung ganyan ka-guwapo BF ko, mapapa-YES nga ako kahit wala pang tanong!
#WillYouMarryMeSerChief#
#WillYouMarryMeRY#
#PeacePoMadam#
would this mean na di natin mapatrend to???? #SCandMayagotEngaged
closed door ba ang proposal at wala man lang pasilip?
Akala ko sa resorts world?
Pre – proposal pa lang yun?
Lucy Anne O’CarrollMas mabuti ngang nalaman ni Maya about the proposal para wala na ang fear nya, kasi baka mabigla instead na YES isasagot nya tatakbo sya s shocking proposal….lol…DE & Nanay Tere are the best moms in the world….very funny ni Maya…ung expect-expect sya palagi pag kasama cla ni SC….nakakatuwa, feeling inayos lang ni SC ung shoe lace nya, akala ni Maya mag-popropose na…….ha ha ha, kayong mga writers ha, THUMBS UP……

Paano na ang #SCAndMayaGotEngaged ?
Nakita ko na naman yung Yes ni Maya sa teaser, hiyang hiya na naman ako Pilyo pa naman si SC, simpleng mang-asar
Naalala ko yung scene na hinati ni SC yung sandwich. Akala ni Maya para sa kanya yun pala ipapatago lang
Kay Amorthis episode brought me again mixed emotions…but i was in tears most of the time..specially yung usapan ng mag inang maya ang NT. each time NT speaks,it is so full of emotions that it made me cry..(galing talaga ni sylvia sanchez).
I find it also amusing that “kinilig” din ang pamilya ni set chief,sa pagiging inspired niya…I so love this episoe..(hahha parang almost episode naman i always say..”i so love this episode)>>..but on anothere level.
and….the teaser..gave me a loud ‘HALAKHAK’..this was my loudest halakhak so far..buti nalang am watchingg it day time na after work..at least wala nang tuolg sa mga other doors ng apartment unit…
MAYA..yes ka na ka agad..hindi pa nag ask si ser chief….baka me pinulot lang…..hahhahahahahahah///sooooo funny,,,have a beurtiful wednesday mga ka minks..monks.
#SafeAngPostKoNgayon#
Akala ko sa resorts world?
Pre – proposal pa lang yun?
Paano na ang #SCAndMayaGotEngaged ?
Baka pati proposal aabot pa ng isang buwan na puro hopia!!!! pati tayo neto magiging aligaga na kagaya ni Maya!!! kung sa Resorts World nga ang proposal, parang simple dinner lang naman ang setting!!!
Sana guniguni lang ni Maya na nakaluhod si SC at napaYES siya ng todo!!! kung sa akin mangyari yun di na ako magpakita kay SC ng ilang buwan dahil sa hiya ko!!
Ako din mas gugustuhin ko pang kainin ng lupa. Kahit gaano pa sya kaguwapo titiisin ko din wag munang magpakita. Magkakasya na muna ako sa pic nya sa celphone or tatanaw tanawin ko na lang from a distance
#StalkStalkLangMuna#
Sana naman hindi abutin ng 1 month. If na-shoot na nila, chances are, hindi naman. Ok lang sa kin to wait a little more sa proposal basta bubugbugin nila tayo ng kilig and funny scenes… at syempre pa, the proposal has to be worth the wait.
Oo nga, wala pa ang ring..nasa Europe pa
Advanced taping lang siguro sila kasi may production number na magaganap sa proposal
Manonood muna ako sa kahiya hiyang teaser
Maria TanWow!! Di naman masyadong excited si Maya YES agad wala pang tanong, ahahahaha, I love it!!!!! I love the scene between Maya and her mother, then SC and his mother, as always BCWMH creative team you never fail to amazed me with your writing skills, it’s almost 1 am and I have watched this episode multiple times already i can feel the excitement on both families.
And SC is soooooo in love with Maya, can’t wait for tomorrows episode i bet it’s going to be hilarious the anticipation of both families, i can’t stop smiling just thinking about the PROPOSAL,……
I am going back to sleep , need my beauty rest got to be at work early tomorrow,…
#DinnerBreak
#SCAndMayaGotEngaged
Napaka-supportive naman ng ‘Team Maya’ sa pagiging assumera niya. Talagang tinuturuan pa sya anong pagkain ang bubulatlatin!
#TheFamilyThatAssumesTogetherMahohopiaTogether#
I think so too. Palagay ko di naman ako mapapahiya na hopia lang talaga yung pagluhod ni SC; di ba yung dinner date nila happened the day after SC met with the jeweller? Impossible namang ready na agad yung ring kinabukasan. Bumabawi lang talaga si SC kasi upset nga si Maya.
#ExcitedJustTheSame
#SanaMayKiligKissSaDinnerDate#
MARIKYN GALICINAOKaloka ka Maya!!!! YYYYEEEEEESSSS agad agad…wala ng tanong?
I think the proposal will happen when Maya least expect it and where she will be surrounded by ALL the people she love….Sana nandoon din si Kute at Cho. OMG!!!! I have to locate my survival kit again.
Paper bag…so I don’ pass out.
Oxygen…just in case i pass out
Large beach towel…to wipe my tears of joy
Xanax, Ativan, Valium…to calm my nerves
Helmet…so I don’t sustain a concussion when I jump for joy.
Depends…if I pee or not.
Ear plugs…for my family and friends.
Water…to swallow my jealous pill.
Glue…to put my broken heart back together again…kasi walang wala na talaga akong pag asa kay SC. Sigh!!!!!!
Katuwa nga eh. naging close ang mga in-laws sa kaka-anticipate sa pagpropose ni SC.
Pano kaya nginuya ni Maya yung pagkain? Baka kinakapa kapa pa ng dila nya kung may ring
#ISecondTheMotionSaHTMo#
Big thanks to Emman kasi kung sakaling di niya pala sinabi kay Maya, pagdating sa proposal, malamang her reaction will be nganga, tulaley, walkout!
Also, welcome back Maya the Assumera! with a team pa talaga
Cyberowl, you were right! Hilarious scenes nga ang nangyari and more to come pa
Linda BernardoThis episode is so hilarious I am smiling from beginning to end. Napunit yata ang labi ko kangingiti.
Doris and Sabel were acting strangely or not their usual self when they greeted SC. SC wondered what it is all about. Manang Fe was delighted to see Richard and was happy for him on his life changing decision “This is it Manang” as SC kissed her. What a poignant moment between her charge and former yaya.
NT was not able to stop Emman from blurting the SC’s secret Maya went into a trance after Emman told her, SC is about to propose to her. Everyone around Maya was so concern on her welfare. She was in a state of shock. Mamang asked Kute to call Maya she might be able to bring Maya back to earth. Kute will call Maya later giving her more time to think things through.
Maya and SC are reminiscing different milestones of their relationship; first kiss on prom night, SC asked Maya out on a date for the first time, on their first date they missed the dinner cruise, tayo na /you & me” moments give me the chills, goose bumps and super kilig to the bones all roll into one..
NT and Dona E each has heart to heart talk to Maya and SC, respectively. SC was concern about Maya she might not be ready. He promised her he would not rush her. She just started her career. Dona E let SC know Maya is the only one who can decide if she’s ready or not. And if Maya is not ready because of fears, SC should understand her. On the other hand, NT told Maya she is the only one who can decide where she would be the happiest or where her choice of priority lies.
At breakfast table Maya was in cloud nine when SC called. SC was in 8th heaven mode inviting Maya for a fine dining to make up for his cancelled dinner date with Maya. The audiences on both ends of the lines are eavesdropping on lovebirds’ conversation. Everyone is thrilled anticipating that this will be the “proposal day”. As soon as SC hung up the phone, Emman screamed at the top of his lungs. He reminded Maya to watch what she eats because SC may put the engagement ring in between food. Team Maya stated different scenarios of proposal that could happen. That triggers Maya’s high anticipation to that magical moment. This is not good baka ma HOPIA si Maya. Remember the ring, SC just gave the specification to Ms. Abueg. Then again who knows someone could have pulled some string to make the ring agad agad.
Finally, Kute and Maya talked. Being nervous and excited, Maya fears she could faint if SC pop the question. Kute warned Maya out of her nervousness and excitement Maya could say YES before SC can express his proposal. At the “teaser” SC is on his knees. He may have dropped something or tying his shoe lace not really proposing. That is how it looks like. It would be very embarrassing if that is the case
Sukiyaki 616Emman dapat ka talagang makutusan
Laging nag a-appear ng di inaasahan
Pangalawang halik sa may pintuan
Ikaw ang muntik nang mahalikan
Sa susunod naman nahulog ka sa hagdanan
Ngayon naman si Ser Chief pa iyong inunahan
Kung sabagay matinik kang manghula
Mukha ni Ms. Abueg iyong nakilala
Sa isang magasin na pang trahe de boda
Bakit naman ang magasing ito meron ka?
Hindi naman sa lahat Emman ay salot ka
Ika’y naging mabuting kaibigan kay Maya
Wala nang mahihiling sa isang kaibigan
Naipakita ever ready makipagtulungan
Mula pa sa simula sa inyong paaralan
Bukas ang puso mo mabilis magpautang
Fashion guru make-up artist iyong kaalaman
Ikaw ang champion pagdating sa bonggahan
Itong huli mong pagdulas ng dila
Naghimatayan ang buong madla
Marami ang mga nagalit di natuwa
Ngunit ito ay di dapat ikabahala
Ang pagmamahal sa iyo hindi mawawala
Nag-iisa kang Emman..ikaw at walang iba!
Willand Cebedozombie looks.
maya looks like the most beautiful zombie i have ever seen. symptoms are
tulala, tuliro, and confuse (some mild zombies would likely to review their
slam book to find some connections to the real world. i wonder how many
zombies out their after knowing that they have just been proposed.
her plan.
her plan is to tour around the world before she would marry.
to be in paradise island like hawaii,aloha maya! where people spend their time
basking in waikiki beach. to japan, the homeland of engineer yamaguchi.
to china where most of her household items have the label made from china
and the ancestral home of lim’s family. lastly, to san nicholas where she
is hoping that he would bring her to the most romantic place in the world.
(writer change their minds after knowing that san nicholas is flooded after
the recent typhoon) bummer!
hugging moments.
it is nice to know that donya esmeralda and donya conchita come to term to
each other. they should realize that they would soon be “kapamilya” and any
kind of discussions are not beneficial to the would-be in laws. but most
important is to stop bashing each other and once and for all stop their
comparison regarding the pork barrel issue.
touching moments.
when mother theresa assured maya that whatever happens, they would always be by
her side. that could only mean that if ever sir chief will have cold feet,
and decide to postpone the wedding qouting his favorite line like
“i am sorry maya, something came up.” nice to know then that they are always
there no matter what. kapit bisig.
sleepless night of maya:
about what would happen if he is going to propose to her and be his wife.
she keeps repeating herself whether she would get use to her new name,
maya de la rosa lim.
mrs. maya lim for short and she doesn’t even look like a chinese lady.
and for sure she has to get use of eating the chinese noodle from chow king.
the dinner invitation from sir chief.
exciting for her. this is the first time that sir chief bringing maya to the
fine dining. and fine dining includes a nice expensive wine and we know that
maya is an expert already after being so drunk during their training in wine
tasting class.
by now, she would know the difference between red and white wine. and to
drink in moderation. she would not like herself vomiting on sir chief
before he would say “will you marry me?”
the lady in red.
wow, what a beautiful dress maya’s wearing before the moment of the unsurprised
proposal. she was beautiful indeed. no wonder sir chief is head over heels in
love toward maya’s simple but elegant beauty.
finally, tomorrow, we will see how mahal na hari kneeling before mahal na princesa
and asking her hand in marriage. (i will tell my children to cook for their own
dinner because i am very busy and i will not entertain any distractions)

Paapak nga po pala sa bagong bahay
Am hoping na ang scene na yan ay kagaya nung scene ng unang pag-amin ni Maya na crush niya si SC…na panaginip lang pala! pero may advantage rin na alam na ni SC kung ano ang isasagot ni Maya sa kanyang proposal, bumawi na lang siya sa actual na proposal!!!
Normita BaisasIt never seizes to amaze me how the writers of this show can make every episode so exciting and leaves the viewers craving for more, I love it!! I just
finished watching the show with a big smile on my face. Richard and Jodi’s chemistry is very evident. If I didn’t know that Richard is a family man, I would
really think that he likes Jodi…. wishful thinking…
Kung maka-YES naman itong si Maya, wagas! Excited ako sa magiging reaction ni SC at kung anong gagawing palusot ni Maya. Kasi naman eh, sobrang atat lang din ng mga nasa condo sa proposal na yan!
Yes. mas confident na si SC kasi alam na nyang magye yes si Maya kaya pwede na nyang gawing super bongga ang proposal.
Dapat lang talaga ma-exceed yung highest expectations nating mga adiks! parang satin magpo-propose eh
Ay kaloka ka lang Maya! excited nag – Yes! for sure laugh trip bukas. Maghihinala si SC na alam na ni Maya. i dont think naman sobrang mapapahiya si Maya,makakalusot sya.
i guess yung proposal bigla at pati tayo magugulat.Yung tipong hindi iexpect ni maya dahil sa daming hopia na mangyayari sa kaka expect at assume nya.
Malamang may mapapa-Oh NO rin sa kahihiyan!
#LusotMayaLusot#
Ako ang nahiya para kay Maya
#IsipisipDinNgPalusot
#WagMasyadongExcited
#WagDinMasyadongAssuming
Hot WasabiHi Win,
Thanks for posting your OCD summary. While reading it, it occurred to me that there is something that I would like to bring to the forefront. Amiel being Nikki’s admirer. I like him in his role as a spoiler for Nicolo. Compared to wishy washy Nicolo, Amiel is focused and he knows he is attracted to Nikki’s charms. He does not hesitate to let her know that he is. I guess, personally, I am attracted to men who are decisive. ha ha ha
Another well done summary with your funny sotto voces. By the way, you skipped posting your Teaser Portion. Did you intend not to?
Hindi pa rin po ako nakakausad sa mga would-be embarrassing momentsssss ni Mayabels sa episode bukas! Grabe ito na yung hilarious scenes after Maya knowing about it! Trust lang talaga sa writers!
#BotoPoAkoSaJodiStaMariaYap
#MagtatagoNaPoBaAko
#PahingingAbogado
Usapang burahan ng lipstick offscreen?
#BalikanAngCapturedsaPU
#PatayDinAkoNeto
#TatalonNaBaAkoSaBangin
#ExemptedPoBaAngNewbie
Walang exempted exempted sa kulungan
#PatayKangBataKa
#HanapKitangLawyer#
Sukiyaki 616Winnie, good that now you are injecting more of “you” in your sotto voces. By the way, is she a sibling of the Sotto brothers?
I have a thought about the proposal. During his conversation with DE, SC asked if it was too soon as Maya has not realised her dreams. Maya too was a bit apprehensive at first. I don’t know how the writers will do it but Maya and SC will both say “no” to the proposal. And the show goes on…….
Libreng mangara!!!
Burahan ng lipstick offcam. Dapat walang matitira kahit katiting na bahid ng lipstick.
Ang tawag diyan, behind the SINS.
Gandang gabi sa lahat.
#BusySiAttyKapunanKayNapoles#
#BakaPwedeSiAttyLegarda#
CharDawn pala on M2WI? Ang JoChard kaya kelan?
#PaglaruinAngJoChardsaM2WI
#NaeenjoyKoTongMgaHashtagSaPex#
Baka magselos si Singkit! CJV is the host.
Aaaaaaay masaya yan!!! oo nga pala noh? hihihihi ipush na ang #JochardInMinuteToWinIt
Yun nga ang exciting dyan eh! Selosan mode
#ReelSaStudio
#ReelPaBaTawagDun#
Kay Amorthis episode brought me again mixed emotions…but i was in tears most of the time..specially yung usapan ng mag inang maya ang NT. each time NT speaks,it is so full of emotions that it made me cry..(galing talaga ni sylvia sanchez).
I find it also amusing that “kinilig” din ang pamilya ni set chief,sa pagiging inspired niya…I so love this episoe..(hahha parang almost episode naman i always say..”i so love this episode)>>..but on anothere level.
and….the teaser..gave me a loud ‘HALAKHAK’..this was my loudest halakhak so far..buti nalang am watchingg it day time na after work..at least wala nang tuolg sa mga other doors ng apartment unit…
MAYA..yes ka na ka agad..hindi pa nag ask si ser chief….baka me pinulot lang…..hahhahahahahahah///sooooo funny,,,have a beurtiful wednesday mga ka minks..monks.

Buhay na buhay ang dugo ko sa usapang burahan ng lipstick offscreen. Pwede ding lipatan ng lipstick from Maya to SC
#WagKaMunangTatalonHintayinMoKoSabayTayo#
#WalangExemptedLahatTayoBitay#
#AtLeastMabitayTayongNakangiti
Zel MSin Win, as always you did it again…with your OCD-ness, you just can’t hide it, you just show it ha ha ha… i so luv the mother-daughter/mother-son scenes which were so heartfelt and moving but what sent me to crying out of laughter had been the teaser with the Aligaga Maya, wagas na wagas talaga itong si Maya, punit punit din ang labi sa kakatawa… am sure part 2 later on the next episode. And who would ever forget Eman’s antics, hay Emmy, it’s always a love-hate emo with you ha ha ha
Thanks Sis for this complete summation, I enjoyed it most esp your side notes ha ha ha…
Manny RamosI’m amazed how the entire cast can make this teleserye look so real and very realistic .. gagaling nilang umarte…Sylvia Sanchez is great likewise Marissa Delgado (won 2 FAMAS) , Gloria Sevilla and Noel Trinidad. Divine Valencia (I got her personal autograph when I was in my second year in college at UST) She’s one of the sexiest actress Philippine Movies ever produced, saw all her movies with Jess Lapid)! Pati yung mga kids (Luke, Nikki and Abbey) they are so good and wholesome kids….
Ako din, type ko yang burahan ng lipstick…
Pero hindi kaya feel na feel ni SC ang color ng lipstick ni mayabels… isip nya, bagay din kaya yan sa akin….
#VGlangangpegniSC
#HindisilataloniMayabels
#bittermodelangako
Mas matagal na proseso ang lipatan ng lipstick. Baka di lang picture, video na ang lumabas
#WalaPaNamanPongBitaySaPinasDiBa
#MayOrasPaTayoParaMabuhay
#Waaaaaaaaaah
Kita ko na naman ang teaser…
“Yes, YES SIR CHIEF KO, Yes…”
Nakakaloka… how can maya escape from that humiliation… wait and see na naman tayo… knowing mayabels, malulusotan na niyan..
Para ma-surprise si Maya, ilagay ni SC ang singsing sa loob ng isang balot. Tingnan natin ang galing mo SC.
CTO
#walanatalagangpagasakayrichardlim
#kayrichardyapkaya
#spellasa
Hot WasabiNERVOUS ANTICIPATION
Now that everyone knows that a proposal is impending, Richard’s every move is being scrutinized to the minutest detail. Everybody is eavesdropping on his telephone conversation to get a whiff of when he is going to pop the question and where he is going to do it. The entire Lim household is on their toes as they try to confirm his next move to ascertain when it might happen. Likewise the viewing community is collectively holding their breath in anticipation of the main event.
On the other hand, Maya is being coached to look out for the signs of when “IT” might happen.
1. Emman cautions her to be careful with her food so that she does not ingest the ring, just in case it is hidden in the food.
2. Mamang advises for her to be careful with the drink as he may drop the ring in it.
3. Nanay Teresita tells Maya to be on the lookout for Richard’s move. She informs the latter that when Richard will drop down on his knees, this is the sign that he will definitely ask her the most awaited question of the week, if not her life.
With Maya knowing that Richard will propose to her, she finds it impossible to relax. Consequently, she is so nervous, high strung, excited, and anxious. Her senses are calibrated to high alert. She feels that she is so ready and so aware of the telltale signs of when IT might happen that her reaction time is keyed to snap at the slightest hint that it is forthcoming. It is so hilarious to watch her examine her food to look for the hidden treasure buried within. At the condo, Sir Chief had to get down on the floor to pick something up and Maya immediately assumes that he is going on his knees to propose. Hence, she excitedly exclaims in rapid fire response her positive answer to a question that has not even been asked yet! It is such a hysterical scene!
The brilliant writers of this drama who are aware that its viewing public vicariously experience their emotions through Maya has effectively got them exactly where they can manipulate their reaction to the scenes the actors are portraying. They are so successful that even the subscribers to this drama who has just been contented to silently watch from the sidelines now feel compelled to share their positive reaction to the episodes. Such clever manipulators! They are so skillful and shrewd in their tasteful maneuvers in playing with their emotions.
Another brilliantly plotted episode. Bravo production team! But please be careful with our hearts! Dahan dahan lang baka maraming aatakihin sa puso sa mga pinaggagawa niyo. Hahahahaha.
Actually okay lang yun kasi you are actually giving our hearts its much needed aerobic workout! The torete scenes with Maya enduces just the right aerobic exercise so that we can consider it to be a laughing yoga session. Hahahahaha.
Bat ganito ang mukha ni SC dito? Mukhang galit na galit. Nasa likod ba ni Maya si VG?
#ReylanBilisanMoNangMagingLawyer#
Hindi kasurprise-surprise kung si ser chief ang lumuhod infront of maya
Ang kasurprise-surprise if it is the other way around
Okay, ganito na me >
3rd daughter na ni nanay Teresita si Emmie
Kung mapingot lang oh
Barako Name: Emman Castro
Girlaloo Name: Emmie Castrate
E-Queue Ox4dOh… my… G! Natatawa ako na naluluha sa teaser for tomorrow’s episode… Natatawa kasi kung makapag-“YES, YES, YES SIR CHIEF KO” si Maya… WAGAS!!! LOL! Akala mo may tinanong na si Sir Chief eh “Maya…” pa lang naman ang sinabi…Naluluha kasi I’m SOOOOO EMBARRASSED for her… Anu kaya ang pambawi ni Mayabels sa recent additional “most embarrassing moment” niya??? Maya, ang puso mo… kalma… Be careful with your own heart… Abang-abang din pag may time… LOL na LOL talaga!
Sa tinagal ni Sabel sa mansyon, was that the first time na pinuri ni Ser Chief ang luto ni Sabel?
I think so.
Sa tinagal ko na ding nanonood ng bcwmh it was the first time i saw him actually enjoying his food.
And to think na omelet lang yung kinain nya. sa dami ng masasarap putahe na inihain sa hapag kainan ng mga lim, omelet lang pala ang katapat ni singkit!
Masayang-masaya ang lahat para sa nagbabadyang kasal nina Ser Chief at Maya except for one
Si Lino
Lino, kung si Simon nga tagal nang winagayway yung telang puti … ikaw pala hoping pa rin? Para ka palang kami kay Ser Chief
#SabaySabayNatingI-SpellAngAsa#
Si kute prinisinta agad si Cho na ringbearer
Paano kung hilingin ni maya na siya ang maid of honor?
For tomorrow’s episode, one word for Maya > praning
Body-body na sina mamang at donya esmeralda, ay! buddy-buddy pala
Hindi ba buddha-buddha ?
Goodevening! lilitaw lang ako saglit budy busyhanang peg ko.. I saw pictures sa IG na may hashtag na bcwmh.. Mukhang nasa manila bay ang taping nila ngayon.. At i really feel na matutuloy ang naudlot na cruise dinner date ng mag jowa. at sana doon na din ang proposal
Kung sina nanay Teresita at donya Esmeralda ay magbalae, ano ni donya Esmeralda si mamang?
Ang dapat bang itawag ni DE kay Mamang ay Tita Conchita o kaya Nay Conchita? Lagot.
Konting pampa-GV na monologue before I sleep…
MAYA DELA ROSA-LIM
MAYA DELA ROSA-LIM
MAYA DELA ROSA-LIM
#SanaPwedeRinTalagangJodiStaMariaYap#
#LibreAngMangarap#
#PeroHindiLibreAngAbogado#
#BehaveNaKo#
May tiwala naman ako kay Maya na kaya nyang lusutan ang nakahihiyang sitwasyon na yun. Trained syang lumusot sa Ser Chief nya sa mansyon dati.
Pero ang kinasasangkutang gulo ng mga *******… good luck na lang sa kanila kung malulusutan nila…
#NasingitPaRinTalaga#
#UsapangLusutan#
#PaanoMatatanggalAngHelmet#
Haaaay… GV na lang!!!
SaLoves GemOh My Geee….I feel na may isa dyang maho-hopia sa sobrang pagka-assuming niya…well sana mali ang mga iniisip din natin and I don’t know what the writers instore for us sa tomorrow’s episode…hoping lang na maging natural at kalmado ang acting ni Maya everytime na may dinner date sila ni SC at huwag muna siyang mag ala-ring hunter or magpadala sa mga advises ni Emman…you just can’t blame her ang dami din kasing estuserang nakapaligid sa kanya kaya siguro naguguluhan na rin siya 🙂 For tomorrow’s teaser….I don’t know how to react kung matutuwa ako o mahihiya ako sa reaction ni Maya kaya kung sakaling magkatotoo ang sinabi ni Kute sa kanya patay!….dagdag na naman ito sa most embarrassing experiences niya kaya mamaya pagpatak ng 12AM hindi ko muna panoorin ang episode aabangan ko na lang ang summary ni Ms. Winnie at ang mga reviews niyo para mai-handa ko ang sarili ko 🙂 Baka naisip ko hindi shoe lace ang inayos ni SC baka hindi namalayan ni Maya eh ibang kulay ng sapatos ang suot niya or may butas pala ang isang shoe niya….hay nakuh hanovayan!!! but I also love the convo of Maya & NT and SC & DE with MF to give them heart warming, motherly love advises at least I heard Sir Chief’s side regarding the promise he made to Maya na hindi niya ito mamadaliin at satisfied naman ako sa mga sagot ni DE sa kanya…kaya kita-kitz ulit tayo dito sa forum! Let us all enjoy the roller coaster ride for the much awaited proposal…love…love…love!!!

#MayaDelaRosaLim#
Ang wagas na pag-YES ni Maya…
Parang pang-GRAND LOTTO WINNER lang!!!
#MayaDelaRosaLim#
#AngMasuwertengBabaengMinahalNiSerChief#
@imEliesa24 10h
Pusoo koo!! C ser chief and Maya nsa Sun Cruise Manila Bay…ohMyGee!! Anong nangyayare!! #becarefulwithmyheart
Oh ano naan yang ginagawa nila dyan? dyan ba yung hindi nila natuloy na date kasi nalate sila?
Nakakaaliw lang ang mga hashtag ….
DENNIS VILLACORTELike the previous reviewers, I am extremely masaya about this episode. I especially like the flashback scenes, of Maya and Sir Chief’s courtship, her life back in San Nicolas. We reminisce about all that she’s been through, that they’ve been through, reliving all the kilig moments. Maraming salamat BCWMH for the gift.
Nawa nga ay magising na ating prinsesa sa kanyang malabangungot na fairytale
Peace po sa mga lurker na bantay dyan….
Kami po ay naglalabas lang ng aming saloobin…
Talagang nag-ulanan nga ng HT sa night class at ang titindi ng HT ha, walang uurungan at handang ipaglaban
Naisip ko lang pwedeng panglusot ni Maya…
Maya: Yes! Yes Ser Chief ko! Yes!
SC: (puzzled look) What?
Maya: (realized her mistake) Yes… Yes Ser Chief.. Yes na okay na sina Mamang at Tita Esmeralda… and Yes, okay naman ang lab tests ni Mamang…
OR
The best pa rin kung naimagine lang ni Maya na nagsisigaw sya ng YES!!!!! kasi naman super duper kaka-dyahe kung talagang napa-YES sya…
#MayaDelaRosaLIM
#BehaveNaAko
P.S. sa mahal na prinsesa, hope you’ll realize soon what you’re getting into, pero kung saan ka masaya, suportahan taka…
http://ph.omg.yahoo.com/news/sir-chi…104132944.html
#ExcitedForTheGrandProposal
#MayaDelaRosaLIM

(Credit to all PEx posters) Visit PEx to enjoy all the posts- comments, POVs, pictures, videos, gifs, news articles, etc. from day 1 (July 9, 2012). Here’s the link to thread 29 which gives you the link from thread 1-28 too. Enjoy! http://www.pinoyexchange.com/forums/showthread.php?t=727461
Also posting on FB and Twitter
https://www.facebook.com/groups/406900222729681/
More picture posted daily on my twitter kcrica @esric2002
LAST UPDATE—1/4/2020—–SHARING UPDATES FROM FANS and UPDATING my BCWMH blog with collages, GIFS from my USB copy of my complete BCWMH DVD set and TFC reviews. Thanks for your featured reviews.



Leave a Reply